BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0905 (616 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value U81040-1|AAB39356.1| 283|Tribolium castaneum TC Deformed protein. 23 2.0 U81038-1|AAB39355.1| 412|Tribolium castaneum transcription fact... 23 2.0 AF321227-3|AAK16423.1| 412|Tribolium castaneum Dfd protein. 23 2.0 AF243042-1|AAF68438.1| 126|Tribolium castaneum mutant transcrip... 23 2.0 AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 22 3.6 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 22 3.6 DQ855497-1|ABH88184.1| 127|Tribolium castaneum chemosensory pro... 22 4.7 DQ855492-1|ABH88179.1| 251|Tribolium castaneum chemosensory pro... 22 4.7 AF422804-1|AAL56571.1| 669|Tribolium castaneum ABC transmembran... 21 8.2 >U81040-1|AAB39356.1| 283|Tribolium castaneum TC Deformed protein. Length = 283 Score = 23.0 bits (47), Expect = 2.0 Identities = 10/34 (29%), Positives = 15/34 (44%) Frame = +1 Query: 499 PSTEYNYSVADGHSGDNKSQQEVRDGDVSEGFHN 600 PS EYN + GD ++ + G+HN Sbjct: 33 PSEEYNQNSYIPPGGDFFGNHHIQQQQLQYGYHN 66 >U81038-1|AAB39355.1| 412|Tribolium castaneum transcription factor Deformed protein. Length = 412 Score = 23.0 bits (47), Expect = 2.0 Identities = 10/34 (29%), Positives = 15/34 (44%) Frame = +1 Query: 499 PSTEYNYSVADGHSGDNKSQQEVRDGDVSEGFHN 600 PS EYN + GD ++ + G+HN Sbjct: 33 PSEEYNQNSYIPPGGDFFGNHHIQQQQLQYGYHN 66 >AF321227-3|AAK16423.1| 412|Tribolium castaneum Dfd protein. Length = 412 Score = 23.0 bits (47), Expect = 2.0 Identities = 10/34 (29%), Positives = 15/34 (44%) Frame = +1 Query: 499 PSTEYNYSVADGHSGDNKSQQEVRDGDVSEGFHN 600 PS EYN + GD ++ + G+HN Sbjct: 33 PSEEYNQNSYIPPGGDFFGNHHIQQQQLQYGYHN 66 >AF243042-1|AAF68438.1| 126|Tribolium castaneum mutant transcription factor TcDfd1 protein. Length = 126 Score = 23.0 bits (47), Expect = 2.0 Identities = 10/34 (29%), Positives = 15/34 (44%) Frame = +1 Query: 499 PSTEYNYSVADGHSGDNKSQQEVRDGDVSEGFHN 600 PS EYN + GD ++ + G+HN Sbjct: 33 PSEEYNQNSYIPPGGDFFGNHHIQQQQLQYGYHN 66 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 22.2 bits (45), Expect = 3.6 Identities = 9/22 (40%), Positives = 11/22 (50%) Frame = +3 Query: 171 LPRGPCSVPGRPSCLPRGPCSV 236 L C VPG + R PCS+ Sbjct: 190 LTNAVCFVPGVVAMFSRKPCSI 211 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 22.2 bits (45), Expect = 3.6 Identities = 9/22 (40%), Positives = 11/22 (50%) Frame = +3 Query: 171 LPRGPCSVPGRPSCLPRGPCSV 236 L C VPG + R PCS+ Sbjct: 190 LTNAVCFVPGVVAMFSRKPCSI 211 >DQ855497-1|ABH88184.1| 127|Tribolium castaneum chemosensory protein 11 protein. Length = 127 Score = 21.8 bits (44), Expect = 4.7 Identities = 11/37 (29%), Positives = 15/37 (40%) Frame = +3 Query: 210 CLPRGPCSVPGRPSCYHTSPLRYSSAESVSSQNIVRH 320 C P G P HT + S + S+ I+RH Sbjct: 56 CTPDGAELKRHLPDALHTECSKCSETQKNGSKKIMRH 92 >DQ855492-1|ABH88179.1| 251|Tribolium castaneum chemosensory protein 6 protein. Length = 251 Score = 21.8 bits (44), Expect = 4.7 Identities = 10/24 (41%), Positives = 13/24 (54%) Frame = +2 Query: 494 LPQVPSTTTQ*LMVTPAITSPNKK 565 LP STTT+ + T T P+ K Sbjct: 161 LPPTTSTTTRTTLTTKFTTKPSTK 184 >AF422804-1|AAL56571.1| 669|Tribolium castaneum ABC transmembrane transporter white protein. Length = 669 Score = 21.0 bits (42), Expect = 8.2 Identities = 7/17 (41%), Positives = 12/17 (70%) Frame = -2 Query: 600 VMKPFTYITVAYFLLGL 550 ++ P T +V YF++GL Sbjct: 503 IIIPVTLTSVCYFMIGL 519 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 105,380 Number of Sequences: 336 Number of extensions: 1780 Number of successful extensions: 11 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 15666150 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -