BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0905 (616 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC23G3.02c |sib1||ferrichrome synthetase Sib1|Schizosaccharomy... 27 2.8 SPAC4G9.04c |||cleavage and polyadenylation specificity factor |... 26 3.8 >SPAC23G3.02c |sib1||ferrichrome synthetase Sib1|Schizosaccharomyces pombe|chr 1|||Manual Length = 4924 Score = 26.6 bits (56), Expect = 2.8 Identities = 12/31 (38%), Positives = 19/31 (61%) Frame = +3 Query: 252 CYHTSPLRYSSAESVSSQNIVRHDQPQTIQY 344 CY +S L S+A+ S N++ +QP+ QY Sbjct: 3728 CYLSSLLETSNAKISSRPNVLMPNQPEVKQY 3758 >SPAC4G9.04c |||cleavage and polyadenylation specificity factor |Schizosaccharomyces pombe|chr 1|||Manual Length = 638 Score = 26.2 bits (55), Expect = 3.8 Identities = 18/44 (40%), Positives = 21/44 (47%) Frame = +3 Query: 189 SVPGRPSCLPRGPCSVPGRPSCYHTSPLRYSSAESVSSQNIVRH 320 SVP S + P P PS T P YS+ SVSSQ + H Sbjct: 282 SVPSALSSISSTPFMKPSIPSTIPTIPSAYSA--SVSSQPPLTH 323 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,873,387 Number of Sequences: 5004 Number of extensions: 27906 Number of successful extensions: 77 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 74 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 77 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 269634532 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -