BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0905 (616 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF043443-1|AAC05668.1| 232|Anopheles gambiae putative pupal-spe... 37 6e-04 AF043442-1|AAC05667.1| 231|Anopheles gambiae putative pupal-spe... 37 6e-04 AF043441-1|AAC05666.1| 231|Anopheles gambiae putative pupal-spe... 37 6e-04 AF043440-1|AAC05665.1| 234|Anopheles gambiae putative pupal-spe... 37 6e-04 AF043439-1|AAC05664.1| 239|Anopheles gambiae putative pupal-spe... 37 6e-04 AF043438-1|AAC05663.1| 231|Anopheles gambiae putative pupal-spe... 37 6e-04 AF043437-1|AAC05662.1| 239|Anopheles gambiae putative pupal-spe... 37 6e-04 AF043436-1|AAC05661.1| 263|Anopheles gambiae putative pupal-spe... 37 6e-04 AF043435-1|AAC05660.1| 231|Anopheles gambiae pupal-specific cut... 37 6e-04 AF043434-1|AAC05659.1| 232|Anopheles gambiae putative pupal-spe... 37 6e-04 AF043433-3|AAC05658.1| 231|Anopheles gambiae putative pupal-spe... 37 6e-04 AF043433-2|AAC05657.1| 239|Anopheles gambiae putative pupal-spe... 37 6e-04 AF043433-1|AAC05656.1| 231|Anopheles gambiae putative pupal-spe... 36 0.001 U50469-1|AAA93473.1| 160|Anopheles gambiae protein ( Anopheles ... 32 0.013 AB090816-2|BAC57908.1| 1201|Anopheles gambiae reverse transcript... 24 3.4 DQ383819-1|ABD38144.1| 377|Anopheles gambiae abdominal-B protein. 24 4.5 AY324313-1|AAQ89698.1| 160|Anopheles gambiae insulin-like pepti... 23 5.9 AY324309-1|AAQ89694.1| 160|Anopheles gambiae insulin-like pepti... 23 5.9 AJ297930-1|CAC35450.1| 104|Anopheles gambiae hypothetical prote... 23 7.8 AJ010193-1|CAA09032.1| 684|Anopheles gambiae prophenoloxidase p... 23 7.8 >AF043443-1|AAC05668.1| 232|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 232 Score = 36.7 bits (81), Expect = 6e-04 Identities = 16/28 (57%), Positives = 19/28 (67%) Frame = +1 Query: 508 EYNYSVADGHSGDNKSQQEVRDGDVSEG 591 E++YSV D H+GD KSQ E R GD G Sbjct: 93 EFSYSVHDEHTGDIKSQHETRHGDEVHG 120 Score = 32.3 bits (70), Expect = 0.013 Identities = 19/46 (41%), Positives = 25/46 (54%) Frame = +1 Query: 1 MFSKIVVLCALVAVSKAGLLAAPVHYSPAEAVSSQSIVRHDQPQLH 138 M K V+L LVA + AGLL PV + + A S +I H P +H Sbjct: 1 MAFKFVLLATLVAAASAGLL--PVAHHGSIATSHSTIQHHAAPAIH 44 >AF043442-1|AAC05667.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2c protein. Length = 231 Score = 36.7 bits (81), Expect = 6e-04 Identities = 16/28 (57%), Positives = 19/28 (67%) Frame = +1 Query: 508 EYNYSVADGHSGDNKSQQEVRDGDVSEG 591 E++YSV D H+GD KSQ E R GD G Sbjct: 85 EFSYSVHDEHTGDIKSQHETRHGDEVHG 112 Score = 32.3 bits (70), Expect = 0.013 Identities = 19/46 (41%), Positives = 25/46 (54%) Frame = +1 Query: 1 MFSKIVVLCALVAVSKAGLLAAPVHYSPAEAVSSQSIVRHDQPQLH 138 M K V+L LVA + AGLL PV + + A S +I H P +H Sbjct: 1 MAFKFVLLATLVAAASAGLL--PVAHHGSIATSHSTIQHHAAPAIH 44 >AF043441-1|AAC05666.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 231 Score = 36.7 bits (81), Expect = 6e-04 Identities = 16/28 (57%), Positives = 19/28 (67%) Frame = +1 Query: 508 EYNYSVADGHSGDNKSQQEVRDGDVSEG 591 E++YSV D H+GD KSQ E R GD G Sbjct: 85 EFSYSVHDEHTGDIKSQHETRHGDEVHG 112 Score = 30.7 bits (66), Expect = 0.039 Identities = 20/46 (43%), Positives = 23/46 (50%) Frame = +1 Query: 1 MFSKIVVLCALVAVSKAGLLAAPVHYSPAEAVSSQSIVRHDQPQLH 138 M K V+L LVA AGLL PV + A S SI H P +H Sbjct: 1 MAFKFVLLATLVAAVSAGLL--PVANHGSIATSHSSIQHHAAPAIH 44 >AF043440-1|AAC05665.1| 234|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 234 Score = 36.7 bits (81), Expect = 6e-04 Identities = 16/28 (57%), Positives = 19/28 (67%) Frame = +1 Query: 508 EYNYSVADGHSGDNKSQQEVRDGDVSEG 591 E++YSV D H+GD KSQ E R GD G Sbjct: 85 EFSYSVHDEHTGDIKSQHETRHGDEVHG 112 Score = 29.1 bits (62), Expect = 0.12 Identities = 18/45 (40%), Positives = 24/45 (53%) Frame = +1 Query: 1 MFSKIVVLCALVAVSKAGLLAAPVHYSPAEAVSSQSIVRHDQPQL 135 M K V+L LVA + AGLL PV + + A S +I H P + Sbjct: 1 MAFKFVLLATLVAAASAGLL--PVAHHGSIATSHSTIQHHAAPAI 43 >AF043439-1|AAC05664.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 239 Score = 36.7 bits (81), Expect = 6e-04 Identities = 16/28 (57%), Positives = 19/28 (67%) Frame = +1 Query: 508 EYNYSVADGHSGDNKSQQEVRDGDVSEG 591 E++YSV D H+GD KSQ E R GD G Sbjct: 93 EFSYSVHDEHTGDIKSQHETRHGDEVHG 120 Score = 29.1 bits (62), Expect = 0.12 Identities = 18/45 (40%), Positives = 24/45 (53%) Frame = +1 Query: 1 MFSKIVVLCALVAVSKAGLLAAPVHYSPAEAVSSQSIVRHDQPQL 135 M K V+L LVA + AGLL PV + + A S +I H P + Sbjct: 1 MAFKFVLLATLVAAASAGLL--PVAHHGSIATSHSTIQHHAAPTI 43 >AF043438-1|AAC05663.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 231 Score = 36.7 bits (81), Expect = 6e-04 Identities = 16/28 (57%), Positives = 19/28 (67%) Frame = +1 Query: 508 EYNYSVADGHSGDNKSQQEVRDGDVSEG 591 E++YSV D H+GD KSQ E R GD G Sbjct: 85 EFSYSVHDEHTGDIKSQHETRHGDEVHG 112 Score = 32.3 bits (70), Expect = 0.013 Identities = 19/46 (41%), Positives = 25/46 (54%) Frame = +1 Query: 1 MFSKIVVLCALVAVSKAGLLAAPVHYSPAEAVSSQSIVRHDQPQLH 138 M K V+L LVA + AGLL PV + + A S +I H P +H Sbjct: 1 MAFKFVLLATLVAAASAGLL--PVAHHGSIATSHSTIQHHAAPAIH 44 >AF043437-1|AAC05662.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 239 Score = 36.7 bits (81), Expect = 6e-04 Identities = 16/28 (57%), Positives = 19/28 (67%) Frame = +1 Query: 508 EYNYSVADGHSGDNKSQQEVRDGDVSEG 591 E++YSV D H+GD KSQ E R GD G Sbjct: 93 EFSYSVHDEHTGDIKSQHETRHGDEVHG 120 Score = 33.5 bits (73), Expect = 0.006 Identities = 20/46 (43%), Positives = 25/46 (54%) Frame = +1 Query: 1 MFSKIVVLCALVAVSKAGLLAAPVHYSPAEAVSSQSIVRHDQPQLH 138 M K V+L LVA + AGLL PV + + A S SI H P +H Sbjct: 1 MAFKFVLLATLVAAASAGLL--PVAHHGSIATSHSSIQHHAAPAIH 44 >AF043436-1|AAC05661.1| 263|Anopheles gambiae putative pupal-specific cuticular proteinCP2c protein. Length = 263 Score = 36.7 bits (81), Expect = 6e-04 Identities = 16/28 (57%), Positives = 19/28 (67%) Frame = +1 Query: 508 EYNYSVADGHSGDNKSQQEVRDGDVSEG 591 E++YSV D H+GD KSQ E R GD G Sbjct: 117 EFSYSVHDEHTGDIKSQHETRHGDEVHG 144 Score = 29.1 bits (62), Expect = 0.12 Identities = 18/45 (40%), Positives = 24/45 (53%) Frame = +1 Query: 1 MFSKIVVLCALVAVSKAGLLAAPVHYSPAEAVSSQSIVRHDQPQL 135 M K V+L LVA + AGLL PV + + A S +I H P + Sbjct: 1 MAFKFVLLATLVAAASAGLL--PVAHHGSIATSHSTIQHHAAPAI 43 >AF043435-1|AAC05660.1| 231|Anopheles gambiae pupal-specific cuticular protein CP2b protein. Length = 231 Score = 36.7 bits (81), Expect = 6e-04 Identities = 16/28 (57%), Positives = 19/28 (67%) Frame = +1 Query: 508 EYNYSVADGHSGDNKSQQEVRDGDVSEG 591 E++YSV D H+GD KSQ E R GD G Sbjct: 85 EFSYSVHDEHTGDIKSQHETRHGDEVHG 112 Score = 32.3 bits (70), Expect = 0.013 Identities = 19/46 (41%), Positives = 25/46 (54%) Frame = +1 Query: 1 MFSKIVVLCALVAVSKAGLLAAPVHYSPAEAVSSQSIVRHDQPQLH 138 M K V+L LVA + AGLL PV + + A S +I H P +H Sbjct: 1 MAFKFVLLATLVAAASAGLL--PVAHHGSIATSHSTIQHHAAPAIH 44 >AF043434-1|AAC05659.1| 232|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 232 Score = 36.7 bits (81), Expect = 6e-04 Identities = 16/28 (57%), Positives = 19/28 (67%) Frame = +1 Query: 508 EYNYSVADGHSGDNKSQQEVRDGDVSEG 591 E++YSV D H+GD KSQ E R GD G Sbjct: 93 EFSYSVHDEHTGDIKSQHETRHGDEVHG 120 Score = 32.3 bits (70), Expect = 0.013 Identities = 19/46 (41%), Positives = 25/46 (54%) Frame = +1 Query: 1 MFSKIVVLCALVAVSKAGLLAAPVHYSPAEAVSSQSIVRHDQPQLH 138 M K V+L LVA + AGLL PV + + A S +I H P +H Sbjct: 1 MAFKFVLLATLVAAASAGLL--PVAHHGSIATSHSTIQHHAAPAIH 44 >AF043433-3|AAC05658.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 231 Score = 36.7 bits (81), Expect = 6e-04 Identities = 16/28 (57%), Positives = 19/28 (67%) Frame = +1 Query: 508 EYNYSVADGHSGDNKSQQEVRDGDVSEG 591 E++YSV D H+GD KSQ E R GD G Sbjct: 85 EFSYSVHDEHTGDIKSQHETRHGDEVHG 112 Score = 31.5 bits (68), Expect = 0.022 Identities = 19/46 (41%), Positives = 25/46 (54%) Frame = +1 Query: 1 MFSKIVVLCALVAVSKAGLLAAPVHYSPAEAVSSQSIVRHDQPQLH 138 M K V+L LVA + AGLL PV + + A S +I H P +H Sbjct: 1 MAFKFVLLATLVAAASAGLL--PVAHHGSIASSHSTIQHHAAPAIH 44 >AF043433-2|AAC05657.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 239 Score = 36.7 bits (81), Expect = 6e-04 Identities = 16/28 (57%), Positives = 19/28 (67%) Frame = +1 Query: 508 EYNYSVADGHSGDNKSQQEVRDGDVSEG 591 E++YSV D H+GD KSQ E R GD G Sbjct: 93 EFSYSVHDEHTGDIKSQHETRHGDEVHG 120 Score = 29.1 bits (62), Expect = 0.12 Identities = 18/45 (40%), Positives = 24/45 (53%) Frame = +1 Query: 1 MFSKIVVLCALVAVSKAGLLAAPVHYSPAEAVSSQSIVRHDQPQL 135 M K V+L LVA + AGLL PV + + A S +I H P + Sbjct: 1 MAFKFVLLATLVAAASAGLL--PVAHHGSIATSHSTIQHHAAPTI 43 >AF043433-1|AAC05656.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 231 Score = 35.5 bits (78), Expect = 0.001 Identities = 15/28 (53%), Positives = 19/28 (67%) Frame = +1 Query: 508 EYNYSVADGHSGDNKSQQEVRDGDVSEG 591 E++YSV D H+GD K+Q E R GD G Sbjct: 85 EFSYSVHDEHTGDIKNQHETRHGDEVHG 112 Score = 27.9 bits (59), Expect = 0.28 Identities = 17/45 (37%), Positives = 24/45 (53%) Frame = +1 Query: 1 MFSKIVVLCALVAVSKAGLLAAPVHYSPAEAVSSQSIVRHDQPQL 135 M K V+ LVA + AGLL PV + + A S +I H +P + Sbjct: 1 MAFKFVLFTTLVAAASAGLL--PVAHHGSIATSHSTIQHHARPAI 43 >U50469-1|AAA93473.1| 160|Anopheles gambiae protein ( Anopheles gambiae putativecuticle protein mRNA, partial cds. ). Length = 160 Score = 32.3 bits (70), Expect = 0.013 Identities = 13/21 (61%), Positives = 18/21 (85%) Frame = +1 Query: 538 SGDNKSQQEVRDGDVSEGFHN 600 +GD+KSQQE RDGDV +G ++ Sbjct: 34 TGDSKSQQESRDGDVVQGSYS 54 >AB090816-2|BAC57908.1| 1201|Anopheles gambiae reverse transcriptase protein. Length = 1201 Score = 24.2 bits (50), Expect = 3.4 Identities = 15/40 (37%), Positives = 17/40 (42%), Gaps = 2/40 (5%) Frame = +2 Query: 5 SPKS*YCVL--WSRCRKLDFWLLPCTTLPLKPFLPKALCA 118 SP Y V WS C+KL F C P P LC+ Sbjct: 20 SPTGVYSVRRRWSLCQKLHFRDQVCCVQRSPPHWPYLLCS 59 >DQ383819-1|ABD38144.1| 377|Anopheles gambiae abdominal-B protein. Length = 377 Score = 23.8 bits (49), Expect = 4.5 Identities = 12/37 (32%), Positives = 17/37 (45%), Gaps = 1/37 (2%) Frame = +3 Query: 174 PRGPCSVPGRPSCLPRGPCSVPGRPSCYHT-SPLRYS 281 P PG S P GP +P + + T + LR+S Sbjct: 111 PSAASESPGSVSSQPSGPIHIPAKRPAFDTDTRLRHS 147 >AY324313-1|AAQ89698.1| 160|Anopheles gambiae insulin-like peptide 6 precursor protein. Length = 160 Score = 23.4 bits (48), Expect = 5.9 Identities = 13/42 (30%), Positives = 21/42 (50%) Frame = +1 Query: 13 IVVLCALVAVSKAGLLAAPVHYSPAEAVSSQSIVRHDQPQLH 138 + +L ALV + +++A Y AE V S + + P LH Sbjct: 12 LYILQALVLLWSIAMVSANKRYCGAELVKVLSFLCDEFPDLH 53 >AY324309-1|AAQ89694.1| 160|Anopheles gambiae insulin-like peptide 3 precursor protein. Length = 160 Score = 23.4 bits (48), Expect = 5.9 Identities = 13/42 (30%), Positives = 21/42 (50%) Frame = +1 Query: 13 IVVLCALVAVSKAGLLAAPVHYSPAEAVSSQSIVRHDQPQLH 138 + +L ALV + +++A Y AE V S + + P LH Sbjct: 12 LYILQALVLLWSIAMVSANKRYCGAELVKVLSFLCDEFPDLH 53 >AJ297930-1|CAC35450.1| 104|Anopheles gambiae hypothetical protein protein. Length = 104 Score = 23.0 bits (47), Expect = 7.8 Identities = 14/43 (32%), Positives = 16/43 (37%) Frame = +3 Query: 126 ASAPRCQARCCYPCSLPRGPCSVPGRPSCLPRGPCSVPGRPSC 254 A A C C PC +P + G L G C P R C Sbjct: 15 ALATLCHGACDEPCPVPPKHYAELGCKPILEEGQC-CPKRYQC 56 >AJ010193-1|CAA09032.1| 684|Anopheles gambiae prophenoloxidase protein. Length = 684 Score = 23.0 bits (47), Expect = 7.8 Identities = 12/35 (34%), Positives = 18/35 (51%) Frame = +2 Query: 512 TTTQ*LMVTPAITSPNKKYATVM*VKGFITSFHES 616 T Q + P IT+P+ YA + +G + FH S Sbjct: 54 TNAQTRIPLPNITAPDLAYADAVSRRGGFSIFHPS 88 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 478,734 Number of Sequences: 2352 Number of extensions: 8418 Number of successful extensions: 49 Number of sequences better than 10.0: 20 Number of HSP's better than 10.0 without gapping: 36 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 49 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 60132501 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -