BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0903 (679 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AF322227-1|AAK01654.1| 782|Tribolium castaneum cell surface pro... 27 0.19 AM712902-1|CAN84641.1| 95|Tribolium castaneum hypothetical pro... 23 2.3 AJ005083-1|CAB65469.1| 585|Tribolium castaneum signal receptor ... 23 3.0 >AF322227-1|AAK01654.1| 782|Tribolium castaneum cell surface protein chaoptin protein. Length = 782 Score = 26.6 bits (56), Expect = 0.19 Identities = 15/31 (48%), Positives = 19/31 (61%) Frame = -2 Query: 519 GLDREDVSHRTLCPLPLSACNTAV*LIPSEL 427 GL+R DVSH L LPL++ + A SEL Sbjct: 344 GLERLDVSHNLLGKLPLTSLSLASAQTLSEL 374 >AM712902-1|CAN84641.1| 95|Tribolium castaneum hypothetical protein protein. Length = 95 Score = 23.0 bits (47), Expect = 2.3 Identities = 10/38 (26%), Positives = 19/38 (50%) Frame = -2 Query: 600 C*DIHLFFEVVGSVVGDDPSPREHSRAGLDREDVSHRT 487 C + H+ V+G + P P + S+ + R+ V +T Sbjct: 36 CDEKHVSPHVIGGITSGGPIPTKSSKYPIKRKRVRFQT 73 >AJ005083-1|CAB65469.1| 585|Tribolium castaneum signal receptor protein protein. Length = 585 Score = 22.6 bits (46), Expect = 3.0 Identities = 6/10 (60%), Positives = 9/10 (90%) Frame = -3 Query: 521 LGWTGKMCHI 492 +GWTGK+C + Sbjct: 127 VGWTGKVCDV 136 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 155,024 Number of Sequences: 336 Number of extensions: 3357 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 17697850 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -