BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0903 (679 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 10_08_0520 - 18495118-18498237 29 2.6 11_01_0419 + 3226224-3226756,3228010-3228169,3228256-3228435,322... 28 6.0 >10_08_0520 - 18495118-18498237 Length = 1039 Score = 29.5 bits (63), Expect = 2.6 Identities = 19/59 (32%), Positives = 28/59 (47%), Gaps = 1/59 (1%) Frame = +3 Query: 468 SRAKGKGCDVTHLPGPAQLWNVLVGMDHRRPHSLRLQRTNE-CPNSVILFKSSTKSELY 641 SR KG + H+P +LW +V + + L L R E CP V L+ + + E Y Sbjct: 481 SRVLRKGLE--HIPDSVRLWKAVVELANEEDARLLLHRAVECCPLHVELWLALARLETY 537 >11_01_0419 + 3226224-3226756,3228010-3228169,3228256-3228435, 3228525-3228659,3229262-3229344,3229442-3229535, 3229649-3229735 Length = 423 Score = 28.3 bits (60), Expect = 6.0 Identities = 15/47 (31%), Positives = 22/47 (46%) Frame = +3 Query: 492 DVTHLPGPAQLWNVLVGMDHRRPHSLRLQRTNECPNSVILFKSSTKS 632 D P P +V + DHRR R+ CP+++ L +TKS Sbjct: 166 DAARAPPPGNSPHV-IAFDHRRSTLARIPHLGHCPSNLELNIDTTKS 211 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,662,266 Number of Sequences: 37544 Number of extensions: 302995 Number of successful extensions: 717 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 707 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 717 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1726796312 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -