BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0903 (679 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC001666-1|AAH01666.1| 941|Homo sapiens PRP6 pre-mRNA processin... 30 6.6 AL356790-1|CAH71582.1| 941|Homo sapiens PRP6 pre-mRNA processin... 30 6.6 AL355803-2|CAC16610.2| 941|Homo sapiens PRP6 pre-mRNA processin... 30 6.6 AL118506-15|CAI21906.1| 941|Homo sapiens PRP6 pre-mRNA processi... 30 6.6 AF221842-1|AAF66128.1| 941|Homo sapiens U5 snRNP-associated 102... 30 6.6 AF026031-1|AAD01798.1| 941|Homo sapiens putative mitochondrial ... 30 6.6 AB019219-1|BAA37140.1| 941|Homo sapiens protein ( Homo sapiens ... 30 6.6 >BC001666-1|AAH01666.1| 941|Homo sapiens PRP6 pre-mRNA processing factor 6 homolog (S. cerevisiae) protein. Length = 941 Score = 30.3 bits (65), Expect = 6.6 Identities = 15/48 (31%), Positives = 23/48 (47%), Gaps = 1/48 (2%) Frame = +3 Query: 501 HLPGPAQLWNVLVGMDHRRPHSLRLQRTNE-CPNSVILFKSSTKSELY 641 H+P +LW V ++ + L R E CP SV L+ + + E Y Sbjct: 399 HVPNSVRLWKAAVELEEPEDARIMLSRAVECCPTSVELWLALARLETY 446 >AL356790-1|CAH71582.1| 941|Homo sapiens PRP6 pre-mRNA processing factor 6 homolog (S. cerevisiae) protein. Length = 941 Score = 30.3 bits (65), Expect = 6.6 Identities = 15/48 (31%), Positives = 23/48 (47%), Gaps = 1/48 (2%) Frame = +3 Query: 501 HLPGPAQLWNVLVGMDHRRPHSLRLQRTNE-CPNSVILFKSSTKSELY 641 H+P +LW V ++ + L R E CP SV L+ + + E Y Sbjct: 399 HVPNSVRLWKAAVELEEPEDARIMLSRAVECCPTSVELWLALARLETY 446 >AL355803-2|CAC16610.2| 941|Homo sapiens PRP6 pre-mRNA processing factor 6 homolog (S. cerevisiae) protein. Length = 941 Score = 30.3 bits (65), Expect = 6.6 Identities = 15/48 (31%), Positives = 23/48 (47%), Gaps = 1/48 (2%) Frame = +3 Query: 501 HLPGPAQLWNVLVGMDHRRPHSLRLQRTNE-CPNSVILFKSSTKSELY 641 H+P +LW V ++ + L R E CP SV L+ + + E Y Sbjct: 399 HVPNSVRLWKAAVELEEPEDARIMLSRAVECCPTSVELWLALARLETY 446 >AL118506-15|CAI21906.1| 941|Homo sapiens PRP6 pre-mRNA processing factor 6 homolog (S. cerevisiae) protein. Length = 941 Score = 30.3 bits (65), Expect = 6.6 Identities = 15/48 (31%), Positives = 23/48 (47%), Gaps = 1/48 (2%) Frame = +3 Query: 501 HLPGPAQLWNVLVGMDHRRPHSLRLQRTNE-CPNSVILFKSSTKSELY 641 H+P +LW V ++ + L R E CP SV L+ + + E Y Sbjct: 399 HVPNSVRLWKAAVELEEPEDARIMLSRAVECCPTSVELWLALARLETY 446 >AF221842-1|AAF66128.1| 941|Homo sapiens U5 snRNP-associated 102 kDa protein protein. Length = 941 Score = 30.3 bits (65), Expect = 6.6 Identities = 15/48 (31%), Positives = 23/48 (47%), Gaps = 1/48 (2%) Frame = +3 Query: 501 HLPGPAQLWNVLVGMDHRRPHSLRLQRTNE-CPNSVILFKSSTKSELY 641 H+P +LW V ++ + L R E CP SV L+ + + E Y Sbjct: 399 HVPNSVRLWKAAVELEEPEDARIMLSRAVECCPTSVELWLALARLETY 446 >AF026031-1|AAD01798.1| 941|Homo sapiens putative mitochondrial outer membrane protein import receptor protein. Length = 941 Score = 30.3 bits (65), Expect = 6.6 Identities = 15/48 (31%), Positives = 23/48 (47%), Gaps = 1/48 (2%) Frame = +3 Query: 501 HLPGPAQLWNVLVGMDHRRPHSLRLQRTNE-CPNSVILFKSSTKSELY 641 H+P +LW V ++ + L R E CP SV L+ + + E Y Sbjct: 399 HVPNSVRLWKAAVELEEPEDARIMLSRAVECCPTSVELWLALARLETY 446 >AB019219-1|BAA37140.1| 941|Homo sapiens protein ( Homo sapiens mRNA, complete cds, similar to yeast pre-mRNA splicing factors, Prp1/Zer1 and Prp6. ). Length = 941 Score = 30.3 bits (65), Expect = 6.6 Identities = 15/48 (31%), Positives = 23/48 (47%), Gaps = 1/48 (2%) Frame = +3 Query: 501 HLPGPAQLWNVLVGMDHRRPHSLRLQRTNE-CPNSVILFKSSTKSELY 641 H+P +LW V ++ + L R E CP SV L+ + + E Y Sbjct: 399 HVPNSVRLWKAAVELEEPEDARIMLSRAVECCPTSVELWLALARLETY 446 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 88,794,385 Number of Sequences: 237096 Number of extensions: 1803628 Number of successful extensions: 3544 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 3383 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3544 length of database: 76,859,062 effective HSP length: 88 effective length of database: 55,994,614 effective search space used: 7671262118 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -