BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0902 (701 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 10_01_0167 + 1876793-1877402,1877423-1877642,1877760-1879534,188... 28 6.2 02_05_0967 - 33148283-33148524,33148602-33148881,33148959-331491... 28 8.3 >10_01_0167 + 1876793-1877402,1877423-1877642,1877760-1879534, 1880019-1880199,1881313-1881529 Length = 1000 Score = 28.3 bits (60), Expect = 6.2 Identities = 15/44 (34%), Positives = 26/44 (59%) Frame = +2 Query: 2 NNTYLFYSKYVSLRIY*VSLIKNKIMQKLSMSNINIVENYVDDL 133 N LF KY+SLR +S I +I + ++ ++I E +V++L Sbjct: 598 NTDKLFQLKYLSLRGSDISHIPRQIAKLQNLLTLDISETFVEEL 641 >02_05_0967 - 33148283-33148524,33148602-33148881,33148959-33149151, 33149244-33149324,33149395-33149520,33149758-33150137, 33150367-33150394,33150816-33150979,33151920-33152039, 33152168-33152416 Length = 620 Score = 27.9 bits (59), Expect = 8.3 Identities = 9/15 (60%), Positives = 11/15 (73%) Frame = +2 Query: 296 LFITYCNNIVNVWNF 340 LF+T+CN V WNF Sbjct: 475 LFLTFCNRTVAAWNF 489 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,791,937 Number of Sequences: 37544 Number of extensions: 324392 Number of successful extensions: 745 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 724 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 745 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1803843684 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -