BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0902 (701 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_33716| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.8 SB_36072| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.4 >SB_33716| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 922 Score = 28.7 bits (61), Expect = 4.8 Identities = 11/24 (45%), Positives = 15/24 (62%) Frame = +2 Query: 548 NRSSYVCTNITVAPLAPPTLPFQP 619 N+SS C + +AP+ PP PF P Sbjct: 436 NQSSSHCNSSQLAPMTPPRNPFSP 459 >SB_36072| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 498 Score = 27.9 bits (59), Expect = 8.4 Identities = 18/51 (35%), Positives = 21/51 (41%) Frame = +1 Query: 196 NFKD*TVENAMHVVHWKLTCHCVHWASTHRAMYAIYNLLQ*YC*CLEFHNA 348 N T A H + T H+ +TH A YA Y L YC L H A Sbjct: 24 NHNSHTYFTATHPARYSKTTRYAHY-NTHSARYAHYTLNYSYCTLLTPHAA 73 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,365,043 Number of Sequences: 59808 Number of extensions: 418426 Number of successful extensions: 1034 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 935 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1033 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1841633001 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -