Bombyx BLAST Result against uniref50

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0900
         (363 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_Q7RTD0 Cluster: Nucleoporin nup100/nsp100; n=8; Plasmod...    32   2.7  

>UniRef50_Q7RTD0 Cluster: Nucleoporin nup100/nsp100; n=8; Plasmodium
            (Vinckeia)|Rep: Nucleoporin nup100/nsp100 - Plasmodium
            yoelii yoelii
          Length = 1991

 Score = 32.3 bits (70), Expect = 2.7
 Identities = 16/35 (45%), Positives = 23/35 (65%)
 Frame = +2

Query: 62   NEMLTYY*MSYLINELQKVENFTLHF*FYLVKIPY 166
            NE+ +Y   ++  NE+ K EN T+HF FYLV I +
Sbjct: 1165 NEIFSYCYDNFYKNEMDK-ENCTIHFFFYLVNIMF 1198


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 255,865,722
Number of Sequences: 1657284
Number of extensions: 3914323
Number of successful extensions: 6091
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 6003
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 6091
length of database: 575,637,011
effective HSP length: 90
effective length of database: 426,481,451
effective search space used: 12794443530
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)