BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0896 (230 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 09_06_0087 + 20771329-20771450,20771462-20771771,20771893-207726... 30 0.23 02_02_0188 + 7617838-7620231,7621856-7622071,7622167-7622328,762... 27 2.8 01_06_0181 - 27262425-27263337,27263452-27263633 27 2.8 01_01_0369 - 2886060-2886272,2886721-2887434 27 2.8 11_06_0690 + 26303733-26306540 26 3.7 05_05_0168 + 22875488-22876072 26 4.9 12_01_0449 + 3548389-3548503,3549282-3549425,3550087-3550212,355... 25 6.5 07_03_1530 + 27502546-27502671,27503487-27503561,27504670-275047... 25 6.5 01_01_0827 + 6443319-6446085,6446317-6446407,6446502-6448017,644... 25 6.5 10_08_0106 + 14842748-14843085,14843122-14843250,14844145-148442... 25 8.6 02_05_0762 + 31562589-31563272 25 8.6 >09_06_0087 + 20771329-20771450,20771462-20771771,20771893-20772672, 20772854-20774002 Length = 786 Score = 30.3 bits (65), Expect = 0.23 Identities = 13/30 (43%), Positives = 17/30 (56%) Frame = -3 Query: 204 SSILGATSRIG*AGTYVLFLRHWHRQTHIR 115 +S+LG + R G + F RHWHR H R Sbjct: 220 ASVLGWSGRFSVEGASISF-RHWHRSVHAR 248 >02_02_0188 + 7617838-7620231,7621856-7622071,7622167-7622328, 7622466-7622516,7622936-7623070,7623161-7623184, 7623341-7623452,7623776-7623901,7624004-7624053, 7624339-7624497,7624582-7624677,7624751-7624866, 7624907-7624984,7624985-7625108,7625193-7625306, 7625423-7625503,7625616-7625756,7625834-7625848 Length = 1397 Score = 26.6 bits (56), Expect = 2.8 Identities = 15/43 (34%), Positives = 24/43 (55%) Frame = +1 Query: 46 FKKRGNVTGSIFKMKVLLLCIAFADVSLAMPVAEEKDVCSRST 174 F + N+TG I + ++ +C+A +LA P A EK +ST Sbjct: 1312 FDQGDNITGKISREEIAFICVA----ALASPNAVEKTFEVKST 1350 >01_06_0181 - 27262425-27263337,27263452-27263633 Length = 364 Score = 26.6 bits (56), Expect = 2.8 Identities = 9/13 (69%), Positives = 10/13 (76%) Frame = -2 Query: 175 WLSGNIRPFPPPL 137 WL +RPFPPPL Sbjct: 263 WLKDILRPFPPPL 275 >01_01_0369 - 2886060-2886272,2886721-2887434 Length = 308 Score = 26.6 bits (56), Expect = 2.8 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = -2 Query: 148 PPPLASPNSHPRRLCTIVRPS 86 PPP P HP C+ +RP+ Sbjct: 130 PPPPPPPPGHPAYQCSTIRPT 150 >11_06_0690 + 26303733-26306540 Length = 935 Score = 26.2 bits (55), Expect = 3.7 Identities = 11/30 (36%), Positives = 17/30 (56%) Frame = -3 Query: 204 SSILGATSRIG*AGTYVLFLRHWHRQTHIR 115 +++L + R+ AG + F R WHR H R Sbjct: 291 TTVLNQSGRLTVAGAKISF-RRWHRSVHAR 319 >05_05_0168 + 22875488-22876072 Length = 194 Score = 25.8 bits (54), Expect = 4.9 Identities = 17/47 (36%), Positives = 22/47 (46%) Frame = -1 Query: 194 WARLLELVEREHTSFSSATGIAKLTSAKAMHNSKTFILNMDPVTLPR 54 WA + E +S SSA G A +A +MH + PVTL R Sbjct: 56 WACHRYTPDPEASSSSSAAGAAGAAAAASMHGLDAEAIGGLPVTLYR 102 >12_01_0449 + 3548389-3548503,3549282-3549425,3550087-3550212, 3550468-3550619,3551118-3551402 Length = 273 Score = 25.4 bits (53), Expect = 6.5 Identities = 17/47 (36%), Positives = 21/47 (44%), Gaps = 6/47 (12%) Frame = -1 Query: 209 PSHQFW----ARLLELVEREHTSF--SSATGIAKLTSAKAMHNSKTF 87 PS + W A+ L + E +F SAT L A NSKTF Sbjct: 176 PSGEVWVGNPAKFLRKLTEEEIAFIAQSATNYINLAQVHAAENSKTF 222 >07_03_1530 + 27502546-27502671,27503487-27503561,27504670-27504746, 27505576-27507522,27508478-27508946,27509898-27510079, 27510746-27511208,27511295-27511691,27511810-27511937, 27512106-27512273,27512452-27512559,27512830-27512838 Length = 1382 Score = 25.4 bits (53), Expect = 6.5 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = +2 Query: 143 RRKRTYVPAQPILEVAPKIDDSVKP 217 R+ T + PI+ VAPK D+ ++P Sbjct: 365 RKPHTNHISNPIISVAPKTDEELQP 389 >01_01_0827 + 6443319-6446085,6446317-6446407,6446502-6448017, 6448164-6448243,6449045-6449129,6449221-6449312, 6449388-6449456,6449544-6449580,6449662-6449744, 6450427-6450873,6450978-6451014,6451101-6451158, 6451243-6451382,6451610-6451675,6451794-6451908, 6453261-6453299,6453482-6453543 Length = 1927 Score = 25.4 bits (53), Expect = 6.5 Identities = 13/44 (29%), Positives = 19/44 (43%) Frame = +1 Query: 43 CFKKRGNVTGSIFKMKVLLLCIAFADVSLAMPVAEEKDVCSRST 174 C K + N + + AFA LA+P EEK + + T Sbjct: 1582 CTKSKPNCNACPMRAECKHFASAFASARLALPGPEEKSLVTSGT 1625 >10_08_0106 + 14842748-14843085,14843122-14843250,14844145-14844211, 14847177-14847324,14847998-14848097,14848306-14848384, 14848527-14848687,14848829-14848908,14849319-14849475, 14849575-14849723,14849909-14850076,14850426-14850719, 14851002-14851046,14851213-14851462,14851707-14851835, 14852799-14853039,14853977-14854642 Length = 1066 Score = 25.0 bits (52), Expect = 8.6 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = -2 Query: 157 RPFPPPLASPNSHPRR 110 R PPP ASP+ H RR Sbjct: 855 RSAPPPPASPDRHSRR 870 >02_05_0762 + 31562589-31563272 Length = 227 Score = 25.0 bits (52), Expect = 8.6 Identities = 11/22 (50%), Positives = 12/22 (54%) Frame = -2 Query: 166 GNIRPFPPPLASPNSHPRRLCT 101 G +R PPPL S RR CT Sbjct: 82 GMMRRLPPPLPSLRGAMRRTCT 103 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 6,148,540 Number of Sequences: 37544 Number of extensions: 116003 Number of successful extensions: 477 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 470 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 477 length of database: 14,793,348 effective HSP length: 55 effective length of database: 12,728,428 effective search space used: 267296988 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -