BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0896 (230 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY268031-1|AAP23056.1| 810|Apis mellifera dorsal protein splice... 22 1.1 AY268030-1|AAP23055.1| 602|Apis mellifera dorsal protein protein. 22 1.1 DQ435337-1|ABD92652.1| 135|Apis mellifera OBP20 protein. 21 2.6 DQ435336-1|ABD92651.1| 135|Apis mellifera OBP19 protein. 21 2.6 DQ325094-1|ABD14108.1| 175|Apis mellifera complementary sex det... 20 3.5 DQ325093-1|ABD14107.1| 175|Apis mellifera complementary sex det... 20 3.5 DQ325092-1|ABD14106.1| 175|Apis mellifera complementary sex det... 20 3.5 DQ325091-1|ABD14105.1| 175|Apis mellifera complementary sex det... 20 3.5 AY569716-1|AAS86669.1| 406|Apis mellifera complementary sex det... 20 3.5 AY569710-1|AAS86663.1| 408|Apis mellifera complementary sex det... 20 3.5 AY569709-1|AAS86662.1| 408|Apis mellifera complementary sex det... 20 3.5 AY569708-1|AAS86661.1| 408|Apis mellifera complementary sex det... 20 3.5 AY569707-1|AAS86660.1| 408|Apis mellifera complementary sex det... 20 3.5 AY569706-1|AAS86659.1| 397|Apis mellifera complementary sex det... 20 3.5 AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 20 3.5 DQ325067-1|ABD14081.1| 152|Apis mellifera complementary sex det... 19 6.1 DQ325066-1|ABD14080.1| 152|Apis mellifera complementary sex det... 19 6.1 DQ325065-1|ABD14079.1| 152|Apis mellifera complementary sex det... 19 6.1 DQ325064-1|ABD14078.1| 152|Apis mellifera complementary sex det... 19 6.1 DQ325063-1|ABD14077.1| 152|Apis mellifera complementary sex det... 19 6.1 DQ325062-1|ABD14076.1| 152|Apis mellifera complementary sex det... 19 6.1 DQ325061-1|ABD14075.1| 152|Apis mellifera complementary sex det... 19 6.1 DQ288391-1|ABC41341.1| 630|Apis mellifera vasa protein protein. 19 6.1 AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. 19 6.1 AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. 19 6.1 AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. 19 6.1 AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. 19 6.1 AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. 19 6.1 AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. 19 6.1 AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein. 19 6.1 AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex det... 19 6.1 AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex det... 19 6.1 AB022907-1|BAA86908.1| 615|Apis mellifera glucose oxidase protein. 19 8.0 >AY268031-1|AAP23056.1| 810|Apis mellifera dorsal protein splice variant B protein. Length = 810 Score = 21.8 bits (44), Expect = 1.1 Identities = 12/41 (29%), Positives = 20/41 (48%) Frame = +1 Query: 34 LCQCFKKRGNVTGSIFKMKVLLLCIAFADVSLAMPVAEEKD 156 +C+ +V G M+++LLC A + + EEKD Sbjct: 225 ICKLSHSNASVAGG---MEMILLCEKVAKEDIQVRFFEEKD 262 >AY268030-1|AAP23055.1| 602|Apis mellifera dorsal protein protein. Length = 602 Score = 21.8 bits (44), Expect = 1.1 Identities = 12/41 (29%), Positives = 20/41 (48%) Frame = +1 Query: 34 LCQCFKKRGNVTGSIFKMKVLLLCIAFADVSLAMPVAEEKD 156 +C+ +V G M+++LLC A + + EEKD Sbjct: 225 ICKLSHSNASVAGG---MEMILLCEKVAKEDIQVRFFEEKD 262 >DQ435337-1|ABD92652.1| 135|Apis mellifera OBP20 protein. Length = 135 Score = 20.6 bits (41), Expect = 2.6 Identities = 8/15 (53%), Positives = 9/15 (60%) Frame = +1 Query: 10 N*YFYFNNLCQCFKK 54 N Y FN L +CF K Sbjct: 111 NIYIRFNKLVKCFGK 125 >DQ435336-1|ABD92651.1| 135|Apis mellifera OBP19 protein. Length = 135 Score = 20.6 bits (41), Expect = 2.6 Identities = 8/15 (53%), Positives = 9/15 (60%) Frame = +1 Query: 10 N*YFYFNNLCQCFKK 54 N Y FN L +CF K Sbjct: 111 NIYIRFNKLVKCFGK 125 >DQ325094-1|ABD14108.1| 175|Apis mellifera complementary sex determiner protein. Length = 175 Score = 20.2 bits (40), Expect = 3.5 Identities = 8/17 (47%), Positives = 10/17 (58%) Frame = +1 Query: 145 EEKDVCSRSTNSRSRAQ 195 EE+ C R + SR R Q Sbjct: 31 EERTSCKRYSRSREREQ 47 >DQ325093-1|ABD14107.1| 175|Apis mellifera complementary sex determiner protein. Length = 175 Score = 20.2 bits (40), Expect = 3.5 Identities = 8/17 (47%), Positives = 10/17 (58%) Frame = +1 Query: 145 EEKDVCSRSTNSRSRAQ 195 EE+ C R + SR R Q Sbjct: 31 EERTSCKRYSRSREREQ 47 >DQ325092-1|ABD14106.1| 175|Apis mellifera complementary sex determiner protein. Length = 175 Score = 20.2 bits (40), Expect = 3.5 Identities = 8/17 (47%), Positives = 10/17 (58%) Frame = +1 Query: 145 EEKDVCSRSTNSRSRAQ 195 EE+ C R + SR R Q Sbjct: 31 EERTSCKRYSRSREREQ 47 >DQ325091-1|ABD14105.1| 175|Apis mellifera complementary sex determiner protein. Length = 175 Score = 20.2 bits (40), Expect = 3.5 Identities = 8/17 (47%), Positives = 10/17 (58%) Frame = +1 Query: 145 EEKDVCSRSTNSRSRAQ 195 EE+ C R + SR R Q Sbjct: 31 EERTSCKRYSRSREREQ 47 >AY569716-1|AAS86669.1| 406|Apis mellifera complementary sex determiner protein. Length = 406 Score = 20.2 bits (40), Expect = 3.5 Identities = 8/17 (47%), Positives = 10/17 (58%) Frame = +1 Query: 145 EEKDVCSRSTNSRSRAQ 195 EE+ C R + SR R Q Sbjct: 264 EERTSCKRYSRSREREQ 280 >AY569710-1|AAS86663.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 20.2 bits (40), Expect = 3.5 Identities = 8/17 (47%), Positives = 10/17 (58%) Frame = +1 Query: 145 EEKDVCSRSTNSRSRAQ 195 EE+ C R + SR R Q Sbjct: 264 EERTSCKRYSRSREREQ 280 >AY569709-1|AAS86662.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 20.2 bits (40), Expect = 3.5 Identities = 8/17 (47%), Positives = 10/17 (58%) Frame = +1 Query: 145 EEKDVCSRSTNSRSRAQ 195 EE+ C R + SR R Q Sbjct: 264 EERTSCKRYSRSREREQ 280 >AY569708-1|AAS86661.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 20.2 bits (40), Expect = 3.5 Identities = 8/17 (47%), Positives = 10/17 (58%) Frame = +1 Query: 145 EEKDVCSRSTNSRSRAQ 195 EE+ C R + SR R Q Sbjct: 264 EERTSCKRYSRSREREQ 280 >AY569707-1|AAS86660.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 20.2 bits (40), Expect = 3.5 Identities = 8/17 (47%), Positives = 10/17 (58%) Frame = +1 Query: 145 EEKDVCSRSTNSRSRAQ 195 EE+ C R + SR R Q Sbjct: 264 EERTSCKRYSRSREREQ 280 >AY569706-1|AAS86659.1| 397|Apis mellifera complementary sex determiner protein. Length = 397 Score = 20.2 bits (40), Expect = 3.5 Identities = 8/17 (47%), Positives = 10/17 (58%) Frame = +1 Query: 145 EEKDVCSRSTNSRSRAQ 195 EE+ C R + SR R Q Sbjct: 253 EERTSCKRYSRSREREQ 269 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 20.2 bits (40), Expect = 3.5 Identities = 10/20 (50%), Positives = 11/20 (55%), Gaps = 2/20 (10%) Frame = -2 Query: 178 NWLSGNIRPFP--PPLASPN 125 +WL PFP P LAS N Sbjct: 644 SWLKDGQSPFPLPPNLASAN 663 >DQ325067-1|ABD14081.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 19.4 bits (38), Expect = 6.1 Identities = 7/19 (36%), Positives = 10/19 (52%) Frame = -2 Query: 166 GNIRPFPPPLASPNSHPRR 110 G + PFPP P+ + R Sbjct: 123 GPLTPFPPRFIPPDMYRLR 141 >DQ325066-1|ABD14080.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 19.4 bits (38), Expect = 6.1 Identities = 7/19 (36%), Positives = 10/19 (52%) Frame = -2 Query: 166 GNIRPFPPPLASPNSHPRR 110 G + PFPP P+ + R Sbjct: 123 GPLTPFPPRFIPPDMYRLR 141 >DQ325065-1|ABD14079.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 19.4 bits (38), Expect = 6.1 Identities = 7/19 (36%), Positives = 10/19 (52%) Frame = -2 Query: 166 GNIRPFPPPLASPNSHPRR 110 G + PFPP P+ + R Sbjct: 123 GPLTPFPPRFIPPDMYRLR 141 >DQ325064-1|ABD14078.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 19.4 bits (38), Expect = 6.1 Identities = 7/19 (36%), Positives = 10/19 (52%) Frame = -2 Query: 166 GNIRPFPPPLASPNSHPRR 110 G + PFPP P+ + R Sbjct: 123 GPLTPFPPRFIPPDMYRLR 141 >DQ325063-1|ABD14077.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 19.4 bits (38), Expect = 6.1 Identities = 7/19 (36%), Positives = 10/19 (52%) Frame = -2 Query: 166 GNIRPFPPPLASPNSHPRR 110 G + PFPP P+ + R Sbjct: 123 GPLTPFPPRFIPPDMYRLR 141 >DQ325062-1|ABD14076.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 19.4 bits (38), Expect = 6.1 Identities = 7/19 (36%), Positives = 10/19 (52%) Frame = -2 Query: 166 GNIRPFPPPLASPNSHPRR 110 G + PFPP P+ + R Sbjct: 123 GPLTPFPPRFIPPDMYRLR 141 >DQ325061-1|ABD14075.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 19.4 bits (38), Expect = 6.1 Identities = 7/19 (36%), Positives = 10/19 (52%) Frame = -2 Query: 166 GNIRPFPPPLASPNSHPRR 110 G + PFPP P+ + R Sbjct: 123 GPLTPFPPRFIPPDMYRLR 141 >DQ288391-1|ABC41341.1| 630|Apis mellifera vasa protein protein. Length = 630 Score = 19.4 bits (38), Expect = 6.1 Identities = 8/15 (53%), Positives = 10/15 (66%) Frame = -1 Query: 188 RLLELVEREHTSFSS 144 RLL+ VE+ FSS Sbjct: 333 RLLDFVEKGRVKFSS 347 >AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 19.4 bits (38), Expect = 6.1 Identities = 7/19 (36%), Positives = 10/19 (52%) Frame = -2 Query: 166 GNIRPFPPPLASPNSHPRR 110 G + PFPP P+ + R Sbjct: 372 GPLTPFPPRFIPPDMYRLR 390 >AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 19.4 bits (38), Expect = 6.1 Identities = 7/19 (36%), Positives = 10/19 (52%) Frame = -2 Query: 166 GNIRPFPPPLASPNSHPRR 110 G + PFPP P+ + R Sbjct: 372 GPLTPFPPRFIPPDMYRLR 390 >AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 19.4 bits (38), Expect = 6.1 Identities = 7/19 (36%), Positives = 10/19 (52%) Frame = -2 Query: 166 GNIRPFPPPLASPNSHPRR 110 G + PFPP P+ + R Sbjct: 372 GPLTPFPPRFIPPDMYRLR 390 >AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 19.4 bits (38), Expect = 6.1 Identities = 7/19 (36%), Positives = 10/19 (52%) Frame = -2 Query: 166 GNIRPFPPPLASPNSHPRR 110 G + PFPP P+ + R Sbjct: 372 GPLTPFPPRFIPPDMYRLR 390 >AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 19.4 bits (38), Expect = 6.1 Identities = 7/19 (36%), Positives = 10/19 (52%) Frame = -2 Query: 166 GNIRPFPPPLASPNSHPRR 110 G + PFPP P+ + R Sbjct: 372 GPLTPFPPRFIPPDMYRLR 390 >AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 19.4 bits (38), Expect = 6.1 Identities = 7/19 (36%), Positives = 10/19 (52%) Frame = -2 Query: 166 GNIRPFPPPLASPNSHPRR 110 G + PFPP P+ + R Sbjct: 372 GPLTPFPPRFIPPDMYRLR 390 >AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein. Length = 400 Score = 19.4 bits (38), Expect = 6.1 Identities = 7/19 (36%), Positives = 10/19 (52%) Frame = -2 Query: 166 GNIRPFPPPLASPNSHPRR 110 G + PFPP P+ + R Sbjct: 371 GPLTPFPPRFIPPDMYRLR 389 >AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex determiner protein. Length = 385 Score = 19.4 bits (38), Expect = 6.1 Identities = 7/19 (36%), Positives = 10/19 (52%) Frame = -2 Query: 166 GNIRPFPPPLASPNSHPRR 110 G + PFPP P+ + R Sbjct: 356 GPLTPFPPRFIPPDMYRLR 374 >AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex determiner protein. Length = 401 Score = 19.4 bits (38), Expect = 6.1 Identities = 7/19 (36%), Positives = 10/19 (52%) Frame = -2 Query: 166 GNIRPFPPPLASPNSHPRR 110 G + PFPP P+ + R Sbjct: 372 GPLTPFPPRFIPPDMYRLR 390 >AB022907-1|BAA86908.1| 615|Apis mellifera glucose oxidase protein. Length = 615 Score = 19.0 bits (37), Expect = 8.0 Identities = 7/13 (53%), Positives = 8/13 (61%) Frame = +3 Query: 102 VHSLRGCEFGDAS 140 VH +RG DAS Sbjct: 567 VHGIRGLRVADAS 579 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 63,524 Number of Sequences: 438 Number of extensions: 1207 Number of successful extensions: 41 Number of sequences better than 10.0: 33 Number of HSP's better than 10.0 without gapping: 38 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 41 length of database: 146,343 effective HSP length: 46 effective length of database: 126,195 effective search space used: 3785850 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 36 (19.4 bits)
- SilkBase 1999-2023 -