BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0895 (664 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY334004-1|AAR01129.1| 194|Anopheles gambiae integrin protein. 25 1.6 AY334003-1|AAR01128.1| 194|Anopheles gambiae integrin protein. 25 1.6 AY334002-1|AAR01127.1| 194|Anopheles gambiae integrin protein. 25 1.6 AY334001-1|AAR01126.1| 194|Anopheles gambiae integrin protein. 25 1.6 AF492464-1|AAM11657.1| 803|Anopheles gambiae beta nu integrin s... 25 1.6 DQ974167-1|ABJ52807.1| 434|Anopheles gambiae serpin 8 protein. 25 2.8 AY423354-1|AAQ94040.1| 112|Anopheles gambiae defender against p... 25 2.8 AJ535203-1|CAD59403.1| 1229|Anopheles gambiae SMC1 protein protein. 25 2.8 AY330179-1|AAQ16285.1| 171|Anopheles gambiae odorant-binding pr... 23 6.5 AJ237706-1|CAB40347.1| 570|Anopheles gambiae putative 5'-nucleo... 23 6.5 AJ000034-1|CAA03870.1| 98|Anopheles gambiae 5'-nucleotidase pr... 23 6.5 AF444783-1|AAL37904.1| 1356|Anopheles gambiae Trex protein. 23 6.5 AF281078-1|AAF82131.1| 2051|Anopheles gambiae vitellogenin 1 pro... 23 6.5 AB090819-1|BAC57913.1| 400|Anopheles gambiae gag-like protein p... 23 6.5 AY045760-4|AAK84945.1| 165|Anopheles gambiae D7-related 4 prote... 23 8.6 AJ302659-1|CAC35524.1| 165|Anopheles gambiae D7r4 protein protein. 23 8.6 AJ292755-1|CAC00630.1| 837|Anopheles gambiae integrin beta subu... 23 8.6 AJ271193-1|CAB66001.1| 1623|Anopheles gambiae laminin gamma 1 pr... 23 8.6 >AY334004-1|AAR01129.1| 194|Anopheles gambiae integrin protein. Length = 194 Score = 25.4 bits (53), Expect = 1.6 Identities = 8/24 (33%), Positives = 13/24 (54%) Frame = -3 Query: 626 NNCGCKSDTMLCVQRASSTMCGNH 555 +NC C +DT C ++ +C H Sbjct: 16 DNCECTTDTTGCKAPSNDAVCSGH 39 >AY334003-1|AAR01128.1| 194|Anopheles gambiae integrin protein. Length = 194 Score = 25.4 bits (53), Expect = 1.6 Identities = 8/24 (33%), Positives = 13/24 (54%) Frame = -3 Query: 626 NNCGCKSDTMLCVQRASSTMCGNH 555 +NC C +DT C ++ +C H Sbjct: 16 DNCECTTDTTGCKAPSNDAVCSGH 39 >AY334002-1|AAR01127.1| 194|Anopheles gambiae integrin protein. Length = 194 Score = 25.4 bits (53), Expect = 1.6 Identities = 8/24 (33%), Positives = 13/24 (54%) Frame = -3 Query: 626 NNCGCKSDTMLCVQRASSTMCGNH 555 +NC C +DT C ++ +C H Sbjct: 16 DNCECTTDTTGCKAPSNDAVCSGH 39 >AY334001-1|AAR01126.1| 194|Anopheles gambiae integrin protein. Length = 194 Score = 25.4 bits (53), Expect = 1.6 Identities = 8/24 (33%), Positives = 13/24 (54%) Frame = -3 Query: 626 NNCGCKSDTMLCVQRASSTMCGNH 555 +NC C +DT C ++ +C H Sbjct: 16 DNCECTTDTTGCKAPSNDAVCSGH 39 >AF492464-1|AAM11657.1| 803|Anopheles gambiae beta nu integrin subunit AgBnu protein. Length = 803 Score = 25.4 bits (53), Expect = 1.6 Identities = 8/24 (33%), Positives = 13/24 (54%) Frame = -3 Query: 626 NNCGCKSDTMLCVQRASSTMCGNH 555 +NC C +DT C ++ +C H Sbjct: 592 DNCECTTDTTGCKAPSNDAVCSGH 615 >DQ974167-1|ABJ52807.1| 434|Anopheles gambiae serpin 8 protein. Length = 434 Score = 24.6 bits (51), Expect = 2.8 Identities = 13/35 (37%), Positives = 19/35 (54%), Gaps = 4/35 (11%) Frame = -1 Query: 208 FHELDKFFVD----HVRIFTPRFDLLGKFILIPIV 116 F ELD+ VD V + P+F+ + LIPI+ Sbjct: 308 FDELDRSLVDFDDDEVEVHLPKFEFNSDYNLIPIL 342 >AY423354-1|AAQ94040.1| 112|Anopheles gambiae defender against programmed cell death protein. Length = 112 Score = 24.6 bits (51), Expect = 2.8 Identities = 8/23 (34%), Positives = 12/23 (52%) Frame = -2 Query: 474 CCVIAAFHFGDRLDAFVSHKRCY 406 CC++ F F L F+S C+ Sbjct: 44 CCLVGTFPFNSFLAGFISTVSCF 66 >AJ535203-1|CAD59403.1| 1229|Anopheles gambiae SMC1 protein protein. Length = 1229 Score = 24.6 bits (51), Expect = 2.8 Identities = 14/56 (25%), Positives = 25/56 (44%) Frame = +2 Query: 8 LEANAKEFDSVLKLYPQAIKLKAERKTKRPDELIKLDNWYQNELPKKIKSRGKDAH 175 +E +E D VLK + + K+ E+ +++ P IK++ K AH Sbjct: 262 IEKRKEEADEVLKEKKKEVGKMTREMAKKEQEIREVEAEMSKRHPMFIKAKEKVAH 317 >AY330179-1|AAQ16285.1| 171|Anopheles gambiae odorant-binding protein AgamOBP53 protein. Length = 171 Score = 23.4 bits (48), Expect = 6.5 Identities = 13/44 (29%), Positives = 21/44 (47%) Frame = +2 Query: 44 KLYPQAIKLKAERKTKRPDELIKLDNWYQNELPKKIKSRGKDAH 175 KLYP K A+ + + + D W Q + ++ + GK AH Sbjct: 88 KLYPLTAKFPADYRHAVRQAIDECDAWLQGKKKERRRPDGK-AH 130 >AJ237706-1|CAB40347.1| 570|Anopheles gambiae putative 5'-nucleotidase protein. Length = 570 Score = 23.4 bits (48), Expect = 6.5 Identities = 14/37 (37%), Positives = 21/37 (56%), Gaps = 1/37 (2%) Frame = +2 Query: 17 NAKE-FDSVLKLYPQAIKLKAERKTKRPDELIKLDNW 124 N+KE + ++Y +LK+E KTK P L DN+ Sbjct: 60 NSKECIAGIARVYHTIKQLKSEYKTKNPLYLNAGDNF 96 >AJ000034-1|CAA03870.1| 98|Anopheles gambiae 5'-nucleotidase protein. Length = 98 Score = 23.4 bits (48), Expect = 6.5 Identities = 14/37 (37%), Positives = 21/37 (56%), Gaps = 1/37 (2%) Frame = +2 Query: 17 NAKE-FDSVLKLYPQAIKLKAERKTKRPDELIKLDNW 124 N+KE + ++Y +LK+E KTK P L DN+ Sbjct: 60 NSKECIAGIARVYHTIKQLKSEYKTKNPLYLNAGDNF 96 >AF444783-1|AAL37904.1| 1356|Anopheles gambiae Trex protein. Length = 1356 Score = 23.4 bits (48), Expect = 6.5 Identities = 10/27 (37%), Positives = 15/27 (55%) Frame = +1 Query: 562 PHMVELALWTHNIVSDLQPQLLGKEPN 642 P+ VEL N++S +Q K+PN Sbjct: 615 PNSVELLYLNDNLISKVQSYTFFKKPN 641 >AF281078-1|AAF82131.1| 2051|Anopheles gambiae vitellogenin 1 protein. Length = 2051 Score = 23.4 bits (48), Expect = 6.5 Identities = 9/34 (26%), Positives = 14/34 (41%) Frame = +2 Query: 26 EFDSVLKLYPQAIKLKAERKTKRPDELIKLDNWY 127 EF++ YP K K D+ I + W+ Sbjct: 1110 EFEASATTYPSIFKTPTGYPEKENDDFIHMPRWF 1143 >AB090819-1|BAC57913.1| 400|Anopheles gambiae gag-like protein protein. Length = 400 Score = 23.4 bits (48), Expect = 6.5 Identities = 15/60 (25%), Positives = 28/60 (46%), Gaps = 4/60 (6%) Frame = +2 Query: 5 FLEANAKEFDSVLKLYPQAIKLKAERKTKRPDELIK----LDNWYQNELPKKIKSRGKDA 172 F+E+ KE + K Q + E +T +P EL + + + +PK+ + R +A Sbjct: 79 FMESMIKEMSELKKQLKQKSTQEIEVQTAQPSELAEDAPFVPQTRKGRVPKEARKRDNNA 138 >AY045760-4|AAK84945.1| 165|Anopheles gambiae D7-related 4 protein protein. Length = 165 Score = 23.0 bits (47), Expect = 8.6 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = +2 Query: 347 ISKAWERPQHQRY*LPLVQ 403 + KA + PQHQRY VQ Sbjct: 136 LKKAGKVPQHQRYTAEFVQ 154 >AJ302659-1|CAC35524.1| 165|Anopheles gambiae D7r4 protein protein. Length = 165 Score = 23.0 bits (47), Expect = 8.6 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = +2 Query: 347 ISKAWERPQHQRY*LPLVQ 403 + KA + PQHQRY VQ Sbjct: 136 LKKAGKVPQHQRYTAEFVQ 154 >AJ292755-1|CAC00630.1| 837|Anopheles gambiae integrin beta subunit protein. Length = 837 Score = 23.0 bits (47), Expect = 8.6 Identities = 8/28 (28%), Positives = 14/28 (50%) Frame = -1 Query: 595 CASRGPALPCVETISCRSRFVPRLTYHR 512 C + C++T +CR +P T+ R Sbjct: 36 CPGKTTCSQCIQTTNCRWCTMPNFTHPR 63 >AJ271193-1|CAB66001.1| 1623|Anopheles gambiae laminin gamma 1 precursor protein. Length = 1623 Score = 23.0 bits (47), Expect = 8.6 Identities = 9/18 (50%), Positives = 11/18 (61%) Frame = -3 Query: 626 NNCGCKSDTMLCVQRASS 573 N CG ++DT CVQ S Sbjct: 67 NTCGDETDTDFCVQTGYS 84 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 758,975 Number of Sequences: 2352 Number of extensions: 17662 Number of successful extensions: 271 Number of sequences better than 10.0: 18 Number of HSP's better than 10.0 without gapping: 268 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 271 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 66068490 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -