BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0892 (646 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC645.06c |rgf3|lad1|RhoGEF Rgf3|Schizosaccharomyces pombe|chr... 31 0.19 SPAC23C4.17 |||tRNA |Schizosaccharomyces pombe|chr 1|||Manual 27 1.8 SPCC1223.01 ||SPCC285.18|ubiquitin-protein ligase E3 |Schizosacc... 27 3.1 SPAC16C9.07 |ppk5|SPAC2G11.01, mug189|serine/threonine protein k... 26 5.3 SPBC8D2.12c |||mitochondrial DNA binding protein |Schizosaccharo... 26 5.3 SPAC2C4.13 |vma16||V-type ATPase subunit c''|Schizosaccharomyces... 25 9.3 SPAC17A5.11 |rec12|spo11|endonuclease Rec12|Schizosaccharomyces ... 25 9.3 >SPCC645.06c |rgf3|lad1|RhoGEF Rgf3|Schizosaccharomyces pombe|chr 3|||Manual Length = 1275 Score = 30.7 bits (66), Expect = 0.19 Identities = 20/65 (30%), Positives = 33/65 (50%), Gaps = 5/65 (7%) Frame = +2 Query: 242 PVPNCPIVSRITIHWPSFYNVVTGKTLALPNLIALQ-----HIPLSPAGVIAKRPAPIAL 406 P+P P+ S ++ H + + +L N I+L ++PLSP A+ P+PI L Sbjct: 170 PLPRPPLPSSVSSHSSPYSTTSSTSLYSLYNDISLSCSPEPYLPLSPTRSPARTPSPIRL 229 Query: 407 PNSCA 421 +S A Sbjct: 230 YSSDA 234 >SPAC23C4.17 |||tRNA |Schizosaccharomyces pombe|chr 1|||Manual Length = 674 Score = 27.5 bits (58), Expect = 1.8 Identities = 14/26 (53%), Positives = 16/26 (61%), Gaps = 1/26 (3%) Frame = -2 Query: 171 RRTDPSKGSASQH-LPPDRKRDPTEK 97 R DP K +AS LPP+ KR TEK Sbjct: 436 RSFDPKKYTASMEILPPENKRQRTEK 461 >SPCC1223.01 ||SPCC285.18|ubiquitin-protein ligase E3 |Schizosaccharomyces pombe|chr 3|||Manual Length = 732 Score = 26.6 bits (56), Expect = 3.1 Identities = 12/25 (48%), Positives = 15/25 (60%) Frame = +1 Query: 355 PPFASWRNSEEARTDRPSQQLRSLN 429 PP AS RN E + PS+Q S+N Sbjct: 353 PPGASGRNRRERTSSTPSEQSTSVN 377 >SPAC16C9.07 |ppk5|SPAC2G11.01, mug189|serine/threonine protein kinase Ppk5 |Schizosaccharomyces pombe|chr 1|||Manual Length = 836 Score = 25.8 bits (54), Expect = 5.3 Identities = 10/26 (38%), Positives = 14/26 (53%) Frame = -2 Query: 615 SPRSLIVDSCSKLEQHSTLSRSILLI 538 SP +L +CS L HST + L+ Sbjct: 28 SPNNLTEQTCSPLRAHSTFKEPVFLL 53 >SPBC8D2.12c |||mitochondrial DNA binding protein |Schizosaccharomyces pombe|chr 2|||Manual Length = 293 Score = 25.8 bits (54), Expect = 5.3 Identities = 12/35 (34%), Positives = 19/35 (54%) Frame = -3 Query: 140 RSIYHRIGNATQLRRSGEKLSGLSLWVKTRHKKTS 36 R++YH SG +SG + W K +HKK++ Sbjct: 11 RALYH-FSRFRSFTTSGWIMSGHNKWSKIKHKKSA 44 >SPAC2C4.13 |vma16||V-type ATPase subunit c''|Schizosaccharomyces pombe|chr 1|||Manual Length = 199 Score = 25.0 bits (52), Expect = 9.3 Identities = 14/34 (41%), Positives = 18/34 (52%) Frame = -1 Query: 607 FFNSGLLFQTGTTLNPISVYSFDL*GILPISAYG 506 F NSG F G+ L S Y++ L GI A+G Sbjct: 24 FHNSGESFDFGSFLLDTSPYTWGLLGIASCVAFG 57 >SPAC17A5.11 |rec12|spo11|endonuclease Rec12|Schizosaccharomyces pombe|chr 1|||Manual Length = 345 Score = 25.0 bits (52), Expect = 9.3 Identities = 9/22 (40%), Positives = 12/22 (54%) Frame = -2 Query: 645 DRRFFAL*RWSPRSLIVDSCSK 580 D +FF + W P L + SC K Sbjct: 221 DAKFFGIFDWDPHGLCIYSCFK 242 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,653,155 Number of Sequences: 5004 Number of extensions: 53994 Number of successful extensions: 124 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 123 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 124 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 289756512 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -