BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0886 (608 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ667186-1|ABG75738.1| 447|Apis mellifera glutamate-gated chlor... 24 1.0 DQ667185-1|ABG75737.1| 447|Apis mellifera glutamate-gated chlor... 24 1.0 S76958-1|AAB33933.1| 90|Apis mellifera olfactory receptor prot... 21 9.4 >DQ667186-1|ABG75738.1| 447|Apis mellifera glutamate-gated chloride channel protein. Length = 447 Score = 24.2 bits (50), Expect = 1.0 Identities = 10/31 (32%), Positives = 16/31 (51%), Gaps = 1/31 (3%) Frame = +1 Query: 235 VHFSRFC-SLIFNGCCNRRVNL*KYTCITVE 324 +H RF F CN + N +Y+C+ V+ Sbjct: 204 LHLPRFTLEKFFTDYCNSKTNTGEYSCLKVD 234 >DQ667185-1|ABG75737.1| 447|Apis mellifera glutamate-gated chloride channel protein. Length = 447 Score = 24.2 bits (50), Expect = 1.0 Identities = 10/31 (32%), Positives = 16/31 (51%), Gaps = 1/31 (3%) Frame = +1 Query: 235 VHFSRFC-SLIFNGCCNRRVNL*KYTCITVE 324 +H RF F CN + N +Y+C+ V+ Sbjct: 204 LHLPRFTLEKFFTDYCNSKTNTGEYSCLKVD 234 >S76958-1|AAB33933.1| 90|Apis mellifera olfactory receptor protein. Length = 90 Score = 21.0 bits (42), Expect = 9.4 Identities = 7/11 (63%), Positives = 8/11 (72%) Frame = -3 Query: 411 HYFESIIPLFK 379 HYF + PLFK Sbjct: 36 HYFRDLQPLFK 46 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 146,646 Number of Sequences: 438 Number of extensions: 2985 Number of successful extensions: 4 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 17971191 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -