BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0885 (445 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 08_02_1345 - 26286448-26286679,26287483-26288038,26288068-262883... 27 9.0 >08_02_1345 - 26286448-26286679,26287483-26288038,26288068-26288358, 26288953-26290516 Length = 880 Score = 26.6 bits (56), Expect = 9.0 Identities = 10/30 (33%), Positives = 18/30 (60%) Frame = +3 Query: 294 LYIEFTEYVLNKILYT*YLKCCNECSNFFV 383 L+ E T++++ + + Y+ CC CS FV Sbjct: 238 LHAESTKHLVGLVYHNPYVACCFLCSETFV 267 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,511,088 Number of Sequences: 37544 Number of extensions: 132779 Number of successful extensions: 195 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 186 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 195 length of database: 14,793,348 effective HSP length: 76 effective length of database: 11,940,004 effective search space used: 847740284 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -