BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0884 (271 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439060-16|CAD27767.1| 278|Anopheles gambiae hypothetical prot... 75 6e-16 DQ655702-1|ABG45862.1| 889|Anopheles gambiae Jxc1 protein. 27 0.12 AJ439060-3|CAD27754.1| 1645|Anopheles gambiae hypothetical prote... 25 0.37 AY324311-1|AAQ89696.1| 158|Anopheles gambiae insulin-like pepti... 25 0.65 AJ459961-1|CAD31060.1| 700|Anopheles gambiae prophenoloxidase 8... 25 0.65 AJ292755-1|CAC00630.1| 837|Anopheles gambiae integrin beta subu... 24 1.1 AY578810-1|AAT07315.1| 897|Anopheles gambiae smurf protein. 23 1.5 AY324312-1|AAQ89697.1| 158|Anopheles gambiae insulin-like pepti... 23 2.0 AJ441131-7|CAD29636.1| 1977|Anopheles gambiae putative Tyr/Ser/T... 23 2.6 AJ439398-6|CAD28129.1| 1978|Anopheles gambiae putative Tyr/Ser/T... 23 2.6 AJ271193-1|CAB66001.1| 1623|Anopheles gambiae laminin gamma 1 pr... 22 3.5 AF203335-1|AAF19830.1| 175|Anopheles gambiae immune-responsive ... 22 3.5 M93689-1|AAA29368.1| 442|Anopheles gambiae protein ( Anopheles ... 21 6.1 AY705396-1|AAU12505.1| 710|Anopheles gambiae nicotinic acetylch... 21 6.1 AF444783-1|AAL37904.1| 1356|Anopheles gambiae Trex protein. 21 6.1 AY825922-1|AAV70485.1| 167|Anopheles gambiae male sterility pro... 21 8.0 AY825921-1|AAV70484.1| 167|Anopheles gambiae male sterility pro... 21 8.0 AY825920-1|AAV70483.1| 167|Anopheles gambiae male sterility pro... 21 8.0 AY825919-1|AAV70482.1| 167|Anopheles gambiae male sterility pro... 21 8.0 AY825918-1|AAV70481.1| 161|Anopheles gambiae male sterility pro... 21 8.0 AY825917-1|AAV70480.1| 161|Anopheles gambiae male sterility pro... 21 8.0 AY825916-1|AAV70479.1| 167|Anopheles gambiae male sterility pro... 21 8.0 AY825915-1|AAV70478.1| 167|Anopheles gambiae male sterility pro... 21 8.0 AY825914-1|AAV70477.1| 167|Anopheles gambiae male sterility pro... 21 8.0 AY825913-1|AAV70476.1| 167|Anopheles gambiae male sterility pro... 21 8.0 AY825912-1|AAV70475.1| 167|Anopheles gambiae male sterility pro... 21 8.0 AY825911-1|AAV70474.1| 167|Anopheles gambiae male sterility pro... 21 8.0 AY825910-1|AAV70473.1| 167|Anopheles gambiae male sterility pro... 21 8.0 AY825909-1|AAV70472.1| 167|Anopheles gambiae male sterility pro... 21 8.0 AY825908-1|AAV70471.1| 168|Anopheles gambiae male sterility pro... 21 8.0 AY825907-1|AAV70470.1| 168|Anopheles gambiae male sterility pro... 21 8.0 AY825906-1|AAV70469.1| 167|Anopheles gambiae male sterility pro... 21 8.0 AY825905-1|AAV70468.1| 167|Anopheles gambiae male sterility pro... 21 8.0 AY825904-1|AAV70467.1| 167|Anopheles gambiae male sterility pro... 21 8.0 AY825903-1|AAV70466.1| 167|Anopheles gambiae male sterility pro... 21 8.0 AY825902-1|AAV70465.1| 167|Anopheles gambiae male sterility pro... 21 8.0 AY825901-1|AAV70464.1| 167|Anopheles gambiae male sterility pro... 21 8.0 AY825900-1|AAV70463.1| 148|Anopheles gambiae male sterility pro... 21 8.0 AY825899-1|AAV70462.1| 148|Anopheles gambiae male sterility pro... 21 8.0 AY825898-1|AAV70461.1| 167|Anopheles gambiae male sterility pro... 21 8.0 AY825897-1|AAV70460.1| 167|Anopheles gambiae male sterility pro... 21 8.0 AY825896-1|AAV70459.1| 167|Anopheles gambiae male sterility pro... 21 8.0 AY825895-1|AAV70458.1| 167|Anopheles gambiae male sterility pro... 21 8.0 AY825894-1|AAV70457.1| 167|Anopheles gambiae male sterility pro... 21 8.0 AY825893-1|AAV70456.1| 167|Anopheles gambiae male sterility pro... 21 8.0 AY825892-1|AAV70455.1| 167|Anopheles gambiae male sterility pro... 21 8.0 AY825891-1|AAV70454.1| 167|Anopheles gambiae male sterility pro... 21 8.0 AY825890-1|AAV70453.1| 167|Anopheles gambiae male sterility pro... 21 8.0 AY825889-1|AAV70452.1| 167|Anopheles gambiae male sterility pro... 21 8.0 AY825888-1|AAV70451.1| 167|Anopheles gambiae male sterility pro... 21 8.0 AY825887-1|AAV70450.1| 167|Anopheles gambiae male sterility pro... 21 8.0 AY825886-1|AAV70449.1| 167|Anopheles gambiae male sterility pro... 21 8.0 AY825885-1|AAV70448.1| 167|Anopheles gambiae male sterility pro... 21 8.0 AY825884-1|AAV70447.1| 167|Anopheles gambiae male sterility pro... 21 8.0 AY825883-1|AAV70446.1| 167|Anopheles gambiae male sterility pro... 21 8.0 AY825882-1|AAV70445.1| 167|Anopheles gambiae male sterility pro... 21 8.0 AY825881-1|AAV70444.1| 167|Anopheles gambiae male sterility pro... 21 8.0 AY825880-1|AAV70443.1| 167|Anopheles gambiae male sterility pro... 21 8.0 AY825879-1|AAV70442.1| 167|Anopheles gambiae male sterility pro... 21 8.0 AY578812-1|AAT07317.1| 932|Anopheles gambiae wishful thinking p... 21 8.0 AJ459962-1|CAD31061.1| 685|Anopheles gambiae prophenoloxidase 9... 21 8.0 AJ276428-1|CAB81934.1| 1322|Anopheles gambiae adhesive serine pr... 21 8.0 >AJ439060-16|CAD27767.1| 278|Anopheles gambiae hypothetical protein protein. Length = 278 Score = 74.5 bits (175), Expect = 6e-16 Identities = 34/62 (54%), Positives = 44/62 (70%), Gaps = 3/62 (4%) Frame = +2 Query: 77 EEWEPEGHTHT---EHTKPYHVTVVKKIGVPIPHPVAVSVPQYVKVPIPQPYPVHVTVEQ 247 +E + GH H+ E +K V V +K+GVP+PHPV ++VP YVKV IPQPYP+ V VEQ Sbjct: 147 KEAQAAGHLHSSVSEKSKTVPVPVFQKVGVPVPHPVPIAVPHYVKVYIPQPYPLQVNVEQ 206 Query: 248 PI 253 PI Sbjct: 207 PI 208 Score = 39.9 bits (89), Expect = 2e-05 Identities = 19/46 (41%), Positives = 27/46 (58%) Frame = +2 Query: 119 KPYHVTVVKKIGVPIPHPVAVSVPQYVKVPIPQPYPVHVTVEQPIL 256 KP TV K + + P V V + +VP+P+PYPV VTV + I+ Sbjct: 222 KPVPYTVEKPYPIEVEKPFPVEVLKKFEVPVPKPYPVPVTVYKHIM 267 Score = 33.1 bits (72), Expect = 0.002 Identities = 16/47 (34%), Positives = 27/47 (57%) Frame = +2 Query: 113 HTKPYHVTVVKKIGVPIPHPVAVSVPQYVKVPIPQPYPVHVTVEQPI 253 H P V K+ +P P+P+ V+V Q +K+PI + P +E+P+ Sbjct: 180 HPVPIAVPHYVKVYIPQPYPLQVNVEQPIKIPIYKVIP--KVIEKPV 224 Score = 30.7 bits (66), Expect = 0.010 Identities = 14/29 (48%), Positives = 17/29 (58%) Frame = +2 Query: 110 EHTKPYHVTVVKKIGVPIPHPVAVSVPQY 196 E KP+ V V+KK VP+P P V V Y Sbjct: 235 EVEKPFPVEVLKKFEVPVPKPYPVPVTVY 263 Score = 27.5 bits (58), Expect = 0.092 Identities = 14/49 (28%), Positives = 26/49 (53%), Gaps = 4/49 (8%) Frame = +2 Query: 119 KPYHVTVVKKIGVPIPHPVAVSVPQYVKVPIP----QPYPVHVTVEQPI 253 +PY + V + PI P+ +P+ ++ P+P +PYP+ V P+ Sbjct: 196 QPYPLQV--NVEQPIKIPIYKVIPKVIEKPVPYTVEKPYPIEVEKPFPV 242 >DQ655702-1|ABG45862.1| 889|Anopheles gambiae Jxc1 protein. Length = 889 Score = 27.1 bits (57), Expect = 0.12 Identities = 10/24 (41%), Positives = 15/24 (62%) Frame = +2 Query: 170 PVAVSVPQYVKVPIPQPYPVHVTV 241 PV + VP + +P+P P PV + V Sbjct: 625 PVTILVPYPIIIPLPLPIPVPIPV 648 Score = 24.6 bits (51), Expect = 0.65 Identities = 7/22 (31%), Positives = 15/22 (68%) Frame = +2 Query: 149 IGVPIPHPVAVSVPQYVKVPIP 214 + + +P+P+ + +P + VPIP Sbjct: 626 VTILVPYPIIIPLPLPIPVPIP 647 Score = 22.6 bits (46), Expect = 2.6 Identities = 9/28 (32%), Positives = 14/28 (50%) Frame = +2 Query: 152 GVPIPHPVAVSVPQYVKVPIPQPYPVHV 235 G P + V P + +P+P P P+ V Sbjct: 621 GAAPPVTILVPYPIIIPLPLPIPVPIPV 648 >AJ439060-3|CAD27754.1| 1645|Anopheles gambiae hypothetical protein protein. Length = 1645 Score = 25.4 bits (53), Expect = 0.37 Identities = 11/31 (35%), Positives = 17/31 (54%) Frame = +1 Query: 91 RRPHAHRTHEAVPCDRGEEDRSSDSPSGGCV 183 RR AH T PC + ++ + + S +GG V Sbjct: 1037 RRKGAHTTFAPGPCQQQQQQQYAGSNAGGTV 1067 Score = 23.0 bits (47), Expect = 2.0 Identities = 8/12 (66%), Positives = 10/12 (83%) Frame = +1 Query: 196 REGAHTSTLPGP 231 R+GAHT+ PGP Sbjct: 1038 RKGAHTTFAPGP 1049 >AY324311-1|AAQ89696.1| 158|Anopheles gambiae insulin-like peptide 5 precursor protein. Length = 158 Score = 24.6 bits (51), Expect = 0.65 Identities = 9/39 (23%), Positives = 21/39 (53%) Frame = -2 Query: 120 FVCSVCVWPSGSHSSEGRALASATKRRTTVVLKAIMLPY 4 + C ++ S +G +A ++RT++V + ++PY Sbjct: 61 WACEKDIYRISRRSGDGNGIAGMMEKRTSMVDEGQLVPY 99 >AJ459961-1|CAD31060.1| 700|Anopheles gambiae prophenoloxidase 8 protein. Length = 700 Score = 24.6 bits (51), Expect = 0.65 Identities = 13/25 (52%), Positives = 15/25 (60%) Frame = -1 Query: 127 VRLRVFCVRVAFGLPFFRRPSAGER 53 +R RV+ R A G PF RR S G R Sbjct: 645 LRDRVYPSRRAMGFPFDRRASNGVR 669 >AJ292755-1|CAC00630.1| 837|Anopheles gambiae integrin beta subunit protein. Length = 837 Score = 23.8 bits (49), Expect = 1.1 Identities = 13/33 (39%), Positives = 14/33 (42%) Frame = -3 Query: 197 RTAGPTQPPDGESELRSSSPRSHGTASCVLCAC 99 R + T P G EL S HGT C C C Sbjct: 630 RASNETCMPPGGGELCSG----HGTCECGTCRC 658 Score = 22.2 bits (45), Expect = 3.5 Identities = 9/26 (34%), Positives = 12/26 (46%) Frame = -3 Query: 176 PPDGESELRSSSPRSHGTASCVLCAC 99 P D E R+ + GT C +C C Sbjct: 500 PSDPEYRERADECSNAGTYKCGICEC 525 >AY578810-1|AAT07315.1| 897|Anopheles gambiae smurf protein. Length = 897 Score = 23.4 bits (48), Expect = 1.5 Identities = 12/34 (35%), Positives = 16/34 (47%) Frame = +3 Query: 159 RFPIRWLCRSRST*RCPYLNPTRSTSQWSNLSCP 260 + P W RS R Y+N T+QWS + P Sbjct: 162 QLPRGWEERSAQNGRTYYVNHYTKTTQWSRPTEP 195 >AY324312-1|AAQ89697.1| 158|Anopheles gambiae insulin-like peptide 5 precursor protein. Length = 158 Score = 23.0 bits (47), Expect = 2.0 Identities = 9/39 (23%), Positives = 20/39 (51%) Frame = -2 Query: 120 FVCSVCVWPSGSHSSEGRALASATKRRTTVVLKAIMLPY 4 + C ++ S +G A ++RT++V + ++PY Sbjct: 61 WACEKDIYRISRRSGDGNGNAGMVEKRTSMVDEGPLVPY 99 >AJ441131-7|CAD29636.1| 1977|Anopheles gambiae putative Tyr/Ser/Thr phosphatase protein. Length = 1977 Score = 22.6 bits (46), Expect = 2.6 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = +3 Query: 219 PTRSTSQWSNLSCPVYK 269 P R+ S W LS P+YK Sbjct: 537 PDRTFSVWPFLSGPIYK 553 >AJ439398-6|CAD28129.1| 1978|Anopheles gambiae putative Tyr/Ser/Thr phosphatase protein. Length = 1978 Score = 22.6 bits (46), Expect = 2.6 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = +3 Query: 219 PTRSTSQWSNLSCPVYK 269 P R+ S W LS P+YK Sbjct: 537 PDRTFSVWPFLSGPIYK 553 >AJ271193-1|CAB66001.1| 1623|Anopheles gambiae laminin gamma 1 precursor protein. Length = 1623 Score = 22.2 bits (45), Expect = 3.5 Identities = 8/20 (40%), Positives = 11/20 (55%) Frame = +1 Query: 124 VPCDRGEEDRSSDSPSGGCV 183 VPCD + DS +G C+ Sbjct: 725 VPCDCNKHAEICDSETGRCI 744 >AF203335-1|AAF19830.1| 175|Anopheles gambiae immune-responsive serine protease-relatedprotein ISPR20 protein. Length = 175 Score = 22.2 bits (45), Expect = 3.5 Identities = 9/21 (42%), Positives = 13/21 (61%) Frame = -3 Query: 221 RVEVWAPSRTAGPTQPPDGES 159 +V + PS TA PT DG++ Sbjct: 74 QVTIVPPSSTASPTTAGDGDA 94 >M93689-1|AAA29368.1| 442|Anopheles gambiae protein ( Anopheles gambiae T1 retroposon. ). Length = 442 Score = 21.4 bits (43), Expect = 6.1 Identities = 9/21 (42%), Positives = 13/21 (61%) Frame = -2 Query: 96 PSGSHSSEGRALASATKRRTT 34 PS +H+S + +AT RTT Sbjct: 156 PSRTHTSTNASSLNATNTRTT 176 >AY705396-1|AAU12505.1| 710|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 3 protein. Length = 710 Score = 21.4 bits (43), Expect = 6.1 Identities = 10/34 (29%), Positives = 14/34 (41%) Frame = -1 Query: 181 HSHRMGNRNSDLLHHGHMVRLRVFCVRVAFGLPF 80 H+HR G HH H +R + LP+ Sbjct: 423 HNHRSGGGGRHHHHHHHSALVRGMDLMDDMPLPY 456 >AF444783-1|AAL37904.1| 1356|Anopheles gambiae Trex protein. Length = 1356 Score = 21.4 bits (43), Expect = 6.1 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = -1 Query: 163 NRNSDLLHHGHMVRLRVFC 107 N N +LH + VRLR+ C Sbjct: 60 NTNFSVLHPENTVRLRLQC 78 Score = 21.0 bits (42), Expect = 8.0 Identities = 7/14 (50%), Positives = 11/14 (78%) Frame = -3 Query: 179 QPPDGESELRSSSP 138 QPP +++LR S+P Sbjct: 1327 QPPSTQAQLRPSAP 1340 >AY825922-1|AAV70485.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 21.0 bits (42), Expect = 8.0 Identities = 9/20 (45%), Positives = 11/20 (55%) Frame = +3 Query: 168 IRWLCRSRST*RCPYLNPTR 227 I+W R T RC NPT+ Sbjct: 4 IKWHEYGRITQRCAVRNPTK 23 >AY825921-1|AAV70484.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 21.0 bits (42), Expect = 8.0 Identities = 9/20 (45%), Positives = 11/20 (55%) Frame = +3 Query: 168 IRWLCRSRST*RCPYLNPTR 227 I+W R T RC NPT+ Sbjct: 4 IKWHEYGRITQRCAVRNPTK 23 >AY825920-1|AAV70483.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 21.0 bits (42), Expect = 8.0 Identities = 9/20 (45%), Positives = 11/20 (55%) Frame = +3 Query: 168 IRWLCRSRST*RCPYLNPTR 227 I+W R T RC NPT+ Sbjct: 4 IKWHEYGRITQRCAVRNPTK 23 >AY825919-1|AAV70482.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 21.0 bits (42), Expect = 8.0 Identities = 9/20 (45%), Positives = 11/20 (55%) Frame = +3 Query: 168 IRWLCRSRST*RCPYLNPTR 227 I+W R T RC NPT+ Sbjct: 4 IKWHEYGRITQRCAVRNPTK 23 >AY825918-1|AAV70481.1| 161|Anopheles gambiae male sterility protein protein. Length = 161 Score = 21.0 bits (42), Expect = 8.0 Identities = 9/20 (45%), Positives = 11/20 (55%) Frame = +3 Query: 168 IRWLCRSRST*RCPYLNPTR 227 I+W R T RC NPT+ Sbjct: 1 IKWHEYGRITQRCAVRNPTK 20 >AY825917-1|AAV70480.1| 161|Anopheles gambiae male sterility protein protein. Length = 161 Score = 21.0 bits (42), Expect = 8.0 Identities = 9/20 (45%), Positives = 11/20 (55%) Frame = +3 Query: 168 IRWLCRSRST*RCPYLNPTR 227 I+W R T RC NPT+ Sbjct: 1 IKWHEYGRITQRCAVRNPTK 20 >AY825916-1|AAV70479.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 21.0 bits (42), Expect = 8.0 Identities = 9/20 (45%), Positives = 11/20 (55%) Frame = +3 Query: 168 IRWLCRSRST*RCPYLNPTR 227 I+W R T RC NPT+ Sbjct: 4 IKWHEYGRITQRCAVRNPTK 23 >AY825915-1|AAV70478.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 21.0 bits (42), Expect = 8.0 Identities = 9/20 (45%), Positives = 11/20 (55%) Frame = +3 Query: 168 IRWLCRSRST*RCPYLNPTR 227 I+W R T RC NPT+ Sbjct: 4 IKWHEYGRITQRCAVRNPTK 23 >AY825914-1|AAV70477.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 21.0 bits (42), Expect = 8.0 Identities = 9/20 (45%), Positives = 11/20 (55%) Frame = +3 Query: 168 IRWLCRSRST*RCPYLNPTR 227 I+W R T RC NPT+ Sbjct: 4 IKWHEYGRITQRCAVRNPTK 23 >AY825913-1|AAV70476.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 21.0 bits (42), Expect = 8.0 Identities = 9/20 (45%), Positives = 11/20 (55%) Frame = +3 Query: 168 IRWLCRSRST*RCPYLNPTR 227 I+W R T RC NPT+ Sbjct: 4 IKWHEYGRITQRCAVRNPTK 23 >AY825912-1|AAV70475.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 21.0 bits (42), Expect = 8.0 Identities = 9/20 (45%), Positives = 11/20 (55%) Frame = +3 Query: 168 IRWLCRSRST*RCPYLNPTR 227 I+W R T RC NPT+ Sbjct: 4 IKWHEYGRITQRCAVRNPTK 23 >AY825911-1|AAV70474.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 21.0 bits (42), Expect = 8.0 Identities = 9/20 (45%), Positives = 11/20 (55%) Frame = +3 Query: 168 IRWLCRSRST*RCPYLNPTR 227 I+W R T RC NPT+ Sbjct: 4 IKWHEYGRITQRCAVRNPTK 23 >AY825910-1|AAV70473.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 21.0 bits (42), Expect = 8.0 Identities = 9/20 (45%), Positives = 11/20 (55%) Frame = +3 Query: 168 IRWLCRSRST*RCPYLNPTR 227 I+W R T RC NPT+ Sbjct: 4 IKWHEYGRITQRCAVRNPTK 23 >AY825909-1|AAV70472.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 21.0 bits (42), Expect = 8.0 Identities = 9/20 (45%), Positives = 11/20 (55%) Frame = +3 Query: 168 IRWLCRSRST*RCPYLNPTR 227 I+W R T RC NPT+ Sbjct: 4 IKWHEYGRITQRCAVRNPTK 23 >AY825908-1|AAV70471.1| 168|Anopheles gambiae male sterility protein protein. Length = 168 Score = 21.0 bits (42), Expect = 8.0 Identities = 9/20 (45%), Positives = 11/20 (55%) Frame = +3 Query: 168 IRWLCRSRST*RCPYLNPTR 227 I+W R T RC NPT+ Sbjct: 4 IKWHEYGRITQRCAVRNPTK 23 >AY825907-1|AAV70470.1| 168|Anopheles gambiae male sterility protein protein. Length = 168 Score = 21.0 bits (42), Expect = 8.0 Identities = 9/20 (45%), Positives = 11/20 (55%) Frame = +3 Query: 168 IRWLCRSRST*RCPYLNPTR 227 I+W R T RC NPT+ Sbjct: 4 IKWHEYGRITQRCAVRNPTK 23 >AY825906-1|AAV70469.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 21.0 bits (42), Expect = 8.0 Identities = 9/20 (45%), Positives = 11/20 (55%) Frame = +3 Query: 168 IRWLCRSRST*RCPYLNPTR 227 I+W R T RC NPT+ Sbjct: 4 IKWHEYGRITQRCAVRNPTK 23 >AY825905-1|AAV70468.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 21.0 bits (42), Expect = 8.0 Identities = 9/20 (45%), Positives = 11/20 (55%) Frame = +3 Query: 168 IRWLCRSRST*RCPYLNPTR 227 I+W R T RC NPT+ Sbjct: 4 IKWHEYGRITQRCAVRNPTK 23 >AY825904-1|AAV70467.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 21.0 bits (42), Expect = 8.0 Identities = 9/20 (45%), Positives = 11/20 (55%) Frame = +3 Query: 168 IRWLCRSRST*RCPYLNPTR 227 I+W R T RC NPT+ Sbjct: 4 IKWHEYGRITQRCAVRNPTK 23 >AY825903-1|AAV70466.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 21.0 bits (42), Expect = 8.0 Identities = 9/20 (45%), Positives = 11/20 (55%) Frame = +3 Query: 168 IRWLCRSRST*RCPYLNPTR 227 I+W R T RC NPT+ Sbjct: 4 IKWHEYGRITQRCAVRNPTK 23 >AY825902-1|AAV70465.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 21.0 bits (42), Expect = 8.0 Identities = 9/20 (45%), Positives = 11/20 (55%) Frame = +3 Query: 168 IRWLCRSRST*RCPYLNPTR 227 I+W R T RC NPT+ Sbjct: 4 IKWHEYGRITQRCAVRNPTK 23 >AY825901-1|AAV70464.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 21.0 bits (42), Expect = 8.0 Identities = 9/20 (45%), Positives = 11/20 (55%) Frame = +3 Query: 168 IRWLCRSRST*RCPYLNPTR 227 I+W R T RC NPT+ Sbjct: 4 IKWHEYGRITQRCAVRNPTK 23 >AY825900-1|AAV70463.1| 148|Anopheles gambiae male sterility protein protein. Length = 148 Score = 21.0 bits (42), Expect = 8.0 Identities = 9/20 (45%), Positives = 11/20 (55%) Frame = +3 Query: 168 IRWLCRSRST*RCPYLNPTR 227 I+W R T RC NPT+ Sbjct: 4 IKWHEYGRITQRCAVRNPTK 23 >AY825899-1|AAV70462.1| 148|Anopheles gambiae male sterility protein protein. Length = 148 Score = 21.0 bits (42), Expect = 8.0 Identities = 9/20 (45%), Positives = 11/20 (55%) Frame = +3 Query: 168 IRWLCRSRST*RCPYLNPTR 227 I+W R T RC NPT+ Sbjct: 4 IKWHEYGRITQRCAVRNPTK 23 >AY825898-1|AAV70461.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 21.0 bits (42), Expect = 8.0 Identities = 9/20 (45%), Positives = 11/20 (55%) Frame = +3 Query: 168 IRWLCRSRST*RCPYLNPTR 227 I+W R T RC NPT+ Sbjct: 4 IKWHEYGRITQRCAVRNPTK 23 >AY825897-1|AAV70460.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 21.0 bits (42), Expect = 8.0 Identities = 9/20 (45%), Positives = 11/20 (55%) Frame = +3 Query: 168 IRWLCRSRST*RCPYLNPTR 227 I+W R T RC NPT+ Sbjct: 4 IKWHEYGRITQRCAVRNPTK 23 >AY825896-1|AAV70459.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 21.0 bits (42), Expect = 8.0 Identities = 9/20 (45%), Positives = 11/20 (55%) Frame = +3 Query: 168 IRWLCRSRST*RCPYLNPTR 227 I+W R T RC NPT+ Sbjct: 4 IKWHEYGRITQRCAVRNPTK 23 >AY825895-1|AAV70458.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 21.0 bits (42), Expect = 8.0 Identities = 9/20 (45%), Positives = 11/20 (55%) Frame = +3 Query: 168 IRWLCRSRST*RCPYLNPTR 227 I+W R T RC NPT+ Sbjct: 4 IKWHEYGRITQRCAVRNPTK 23 >AY825894-1|AAV70457.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 21.0 bits (42), Expect = 8.0 Identities = 9/20 (45%), Positives = 11/20 (55%) Frame = +3 Query: 168 IRWLCRSRST*RCPYLNPTR 227 I+W R T RC NPT+ Sbjct: 4 IKWHEYGRITQRCAVRNPTK 23 >AY825893-1|AAV70456.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 21.0 bits (42), Expect = 8.0 Identities = 9/20 (45%), Positives = 11/20 (55%) Frame = +3 Query: 168 IRWLCRSRST*RCPYLNPTR 227 I+W R T RC NPT+ Sbjct: 4 IKWHEYGRITQRCAVRNPTK 23 >AY825892-1|AAV70455.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 21.0 bits (42), Expect = 8.0 Identities = 9/20 (45%), Positives = 11/20 (55%) Frame = +3 Query: 168 IRWLCRSRST*RCPYLNPTR 227 I+W R T RC NPT+ Sbjct: 4 IKWHEYGRITQRCAVRNPTK 23 >AY825891-1|AAV70454.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 21.0 bits (42), Expect = 8.0 Identities = 9/20 (45%), Positives = 11/20 (55%) Frame = +3 Query: 168 IRWLCRSRST*RCPYLNPTR 227 I+W R T RC NPT+ Sbjct: 4 IKWHEYGRITQRCAVRNPTK 23 >AY825890-1|AAV70453.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 21.0 bits (42), Expect = 8.0 Identities = 9/20 (45%), Positives = 11/20 (55%) Frame = +3 Query: 168 IRWLCRSRST*RCPYLNPTR 227 I+W R T RC NPT+ Sbjct: 4 IKWHEYGRITQRCAVRNPTK 23 >AY825889-1|AAV70452.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 21.0 bits (42), Expect = 8.0 Identities = 9/20 (45%), Positives = 11/20 (55%) Frame = +3 Query: 168 IRWLCRSRST*RCPYLNPTR 227 I+W R T RC NPT+ Sbjct: 4 IKWHEYGRITQRCAVRNPTK 23 >AY825888-1|AAV70451.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 21.0 bits (42), Expect = 8.0 Identities = 9/20 (45%), Positives = 11/20 (55%) Frame = +3 Query: 168 IRWLCRSRST*RCPYLNPTR 227 I+W R T RC NPT+ Sbjct: 4 IKWHEYGRITQRCAVRNPTK 23 >AY825887-1|AAV70450.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 21.0 bits (42), Expect = 8.0 Identities = 9/20 (45%), Positives = 11/20 (55%) Frame = +3 Query: 168 IRWLCRSRST*RCPYLNPTR 227 I+W R T RC NPT+ Sbjct: 4 IKWHEYGRITQRCAVRNPTK 23 >AY825886-1|AAV70449.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 21.0 bits (42), Expect = 8.0 Identities = 9/20 (45%), Positives = 11/20 (55%) Frame = +3 Query: 168 IRWLCRSRST*RCPYLNPTR 227 I+W R T RC NPT+ Sbjct: 3 IKWHEYGRITQRCAVRNPTK 22 >AY825885-1|AAV70448.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 21.0 bits (42), Expect = 8.0 Identities = 9/20 (45%), Positives = 11/20 (55%) Frame = +3 Query: 168 IRWLCRSRST*RCPYLNPTR 227 I+W R T RC NPT+ Sbjct: 3 IKWHEYGRITQRCAVRNPTK 22 >AY825884-1|AAV70447.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 21.0 bits (42), Expect = 8.0 Identities = 9/20 (45%), Positives = 11/20 (55%) Frame = +3 Query: 168 IRWLCRSRST*RCPYLNPTR 227 I+W R T RC NPT+ Sbjct: 4 IKWHEYGRITQRCAVRNPTK 23 >AY825883-1|AAV70446.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 21.0 bits (42), Expect = 8.0 Identities = 9/20 (45%), Positives = 11/20 (55%) Frame = +3 Query: 168 IRWLCRSRST*RCPYLNPTR 227 I+W R T RC NPT+ Sbjct: 4 IKWHEYGRITQRCAVRNPTK 23 >AY825882-1|AAV70445.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 21.0 bits (42), Expect = 8.0 Identities = 9/20 (45%), Positives = 11/20 (55%) Frame = +3 Query: 168 IRWLCRSRST*RCPYLNPTR 227 I+W R T RC NPT+ Sbjct: 4 IKWHEYGRITQRCAVRNPTK 23 >AY825881-1|AAV70444.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 21.0 bits (42), Expect = 8.0 Identities = 9/20 (45%), Positives = 11/20 (55%) Frame = +3 Query: 168 IRWLCRSRST*RCPYLNPTR 227 I+W R T RC NPT+ Sbjct: 4 IKWHEYGRITQRCAVRNPTK 23 >AY825880-1|AAV70443.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 21.0 bits (42), Expect = 8.0 Identities = 9/20 (45%), Positives = 11/20 (55%) Frame = +3 Query: 168 IRWLCRSRST*RCPYLNPTR 227 I+W R T RC NPT+ Sbjct: 4 IKWHEYGRITQRCAVRNPTK 23 >AY825879-1|AAV70442.1| 167|Anopheles gambiae male sterility protein protein. Length = 167 Score = 21.0 bits (42), Expect = 8.0 Identities = 9/20 (45%), Positives = 11/20 (55%) Frame = +3 Query: 168 IRWLCRSRST*RCPYLNPTR 227 I+W R T RC NPT+ Sbjct: 4 IKWHEYGRITQRCAVRNPTK 23 >AY578812-1|AAT07317.1| 932|Anopheles gambiae wishful thinking protein. Length = 932 Score = 21.0 bits (42), Expect = 8.0 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = +2 Query: 77 EEWEPEGHTHTEHTKPY 127 E++ PEG T E+ PY Sbjct: 464 EDFYPEGTTVPEYRAPY 480 >AJ459962-1|CAD31061.1| 685|Anopheles gambiae prophenoloxidase 9 protein. Length = 685 Score = 21.0 bits (42), Expect = 8.0 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = -1 Query: 163 NRNSDLLHHGHMVRLRVFCVRVAFGLPFFRRPSA 62 N N + H +R +++ R A G PF R+P A Sbjct: 620 NENCNDSHSYCGLRDQLYPDRRAMGFPFDRQPVA 653 >AJ276428-1|CAB81934.1| 1322|Anopheles gambiae adhesive serine protease protein. Length = 1322 Score = 21.0 bits (42), Expect = 8.0 Identities = 8/19 (42%), Positives = 10/19 (52%) Frame = -3 Query: 227 PGRVEVWAPSRTAGPTQPP 171 P R + AP + P QPP Sbjct: 388 PSRPTIPAPQQQTPPRQPP 406 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 328,502 Number of Sequences: 2352 Number of extensions: 7298 Number of successful extensions: 87 Number of sequences better than 10.0: 62 Number of HSP's better than 10.0 without gapping: 69 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 80 length of database: 563,979 effective HSP length: 54 effective length of database: 436,971 effective search space used: 15293985 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -