BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0880 (675 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 11_05_0059 - 18724619-18725053 29 3.4 07_03_1391 + 26234647-26235026,26235112-26235226,26235345-262354... 29 4.5 >11_05_0059 - 18724619-18725053 Length = 144 Score = 29.1 bits (62), Expect = 3.4 Identities = 12/20 (60%), Positives = 15/20 (75%) Frame = +1 Query: 79 CLEVCADLFRFYMAHPLLSC 138 CL +C D FRFY+ P+LSC Sbjct: 101 CLVLCFD-FRFYLQAPVLSC 119 >07_03_1391 + 26234647-26235026,26235112-26235226,26235345-26235410, 26235519-26235607,26235717-26235807,26235917-26236063, 26236160-26236252,26236373-26236474,26236581-26237255 Length = 585 Score = 28.7 bits (61), Expect = 4.5 Identities = 13/36 (36%), Positives = 19/36 (52%) Frame = +3 Query: 144 ESNQTFFQSFLKPNLIHLFPIKTNPIY*DIHYWFQI 251 E N FQ FLK N + L +K +P D +W ++ Sbjct: 340 EENFQEFQGFLKDNNVDLTDVKMSPTEEDEEFWSRL 375 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,746,016 Number of Sequences: 37544 Number of extensions: 243040 Number of successful extensions: 425 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 420 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 425 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1714968940 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -