BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0880 (675 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z73899-8|CAA98079.2| 669|Caenorhabditis elegans Hypothetical pr... 27 9.2 >Z73899-8|CAA98079.2| 669|Caenorhabditis elegans Hypothetical protein ZK829.10 protein. Length = 669 Score = 27.5 bits (58), Expect = 9.2 Identities = 13/61 (21%), Positives = 30/61 (49%) Frame = +2 Query: 176 ETKFNTLISHKNQSHILGYSLLVSNKLK*YKHDYFFQSLPQDQQKSTQTFWPNIILHNYE 355 E +FN+ I Q H+ ++ + ++ + ++ Q LP+ + + + FW + +E Sbjct: 561 EKQFNSSILWHRQLHLRSWNR-IEKEMSEEQRNFAHQHLPEKESEDLEEFWKLVYRPFFE 619 Query: 356 T 358 T Sbjct: 620 T 620 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,028,964 Number of Sequences: 27780 Number of extensions: 285810 Number of successful extensions: 723 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 704 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 723 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1529108810 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -