BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0878 (277 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB267886-1|BAF46356.1| 567|Apis mellifera ecdysteroid receptor ... 22 1.2 U15954-1|AAA67442.1| 53|Apis mellifera abaecin precursor protein. 20 6.5 AF442147-1|AAL35348.1| 33|Apis mellifera abaecin precursor pro... 20 6.5 DQ468657-1|ABE02558.1| 322|Apis mellifera 1,4,5-trisphosphate r... 19 8.6 DQ151547-1|ABA39280.1| 405|Apis mellifera tyramine receptor pro... 19 8.6 >AB267886-1|BAF46356.1| 567|Apis mellifera ecdysteroid receptor A isoform protein. Length = 567 Score = 22.2 bits (45), Expect = 1.2 Identities = 13/39 (33%), Positives = 18/39 (46%) Frame = +3 Query: 150 QEETPEKSTGEKKDETPPPKEMRARSTYRFRGSSNVKIL 266 Q E + S + K T P E S Y+FR + + IL Sbjct: 346 QNEYEQPSEEDLKRITNQPSEGEDISDYKFRHITEITIL 384 >U15954-1|AAA67442.1| 53|Apis mellifera abaecin precursor protein. Length = 53 Score = 19.8 bits (39), Expect = 6.5 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = -2 Query: 243 PETGKYYGRAFPWAVGSHPFSPR 175 P+ G+ R FP G PF+P+ Sbjct: 27 PQPGR---RPFPTFPGQGPFNPK 46 >AF442147-1|AAL35348.1| 33|Apis mellifera abaecin precursor protein. Length = 33 Score = 19.8 bits (39), Expect = 6.5 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = -2 Query: 243 PETGKYYGRAFPWAVGSHPFSPR 175 P+ G+ R FP G PF+P+ Sbjct: 13 PQPGR---RPFPTFPGQGPFNPK 32 >DQ468657-1|ABE02558.1| 322|Apis mellifera 1,4,5-trisphosphate receptor protein. Length = 322 Score = 19.4 bits (38), Expect = 8.6 Identities = 7/15 (46%), Positives = 11/15 (73%) Frame = +3 Query: 144 TPQEETPEKSTGEKK 188 TP++ P+ ST +KK Sbjct: 225 TPRKAPPQLSTTDKK 239 >DQ151547-1|ABA39280.1| 405|Apis mellifera tyramine receptor protein. Length = 405 Score = 19.4 bits (38), Expect = 8.6 Identities = 5/12 (41%), Positives = 7/12 (58%) Frame = -2 Query: 240 ETGKYYGRAFPW 205 +T YYG + W Sbjct: 4 QTANYYGDVYQW 15 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 74,712 Number of Sequences: 438 Number of extensions: 1201 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 48 effective length of database: 125,319 effective search space used: 5388717 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 38 (20.3 bits)
- SilkBase 1999-2023 -