BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0876 (568 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g24550.1 68418.m02899 glycosyl hydrolase family 1 protein con... 27 6.6 At5g24540.1 68418.m02898 glycosyl hydrolase family 1 protein con... 27 6.6 >At5g24550.1 68418.m02899 glycosyl hydrolase family 1 protein contains Pfam PF00232 : Glycosyl hydrolase family 1 domain; TIGRFAM TIGR01233: 6-phospho-beta-galactosidase; similar to anther-specific protein ATA27 (GI:2746341) [Arabidopsis thaliana] Length = 534 Score = 27.5 bits (58), Expect = 6.6 Identities = 12/30 (40%), Positives = 19/30 (63%), Gaps = 3/30 (10%) Frame = +3 Query: 462 PEGVHSLVH---EKLRSPSIFITENGLHQF 542 PEG+ L++ K +P+I+ITENG + Sbjct: 394 PEGLRKLLNYIKNKYNNPTIYITENGFDDY 423 >At5g24540.1 68418.m02898 glycosyl hydrolase family 1 protein contains Pfam PF00232 : Glycosyl hydrolase family 1 domain; TIGRFAM TIGR01233: 6-phospho-beta-galactosidase; similar to amygdalin hydrolase isoform AH I precursor (GI:16757966) [Prunus serotina] Length = 534 Score = 27.5 bits (58), Expect = 6.6 Identities = 13/36 (36%), Positives = 21/36 (58%), Gaps = 3/36 (8%) Frame = +3 Query: 462 PEGVHSLVH---EKLRSPSIFITENGLHQFTQMT*T 560 PEG+ +++ K +P+I+ITENG + T T Sbjct: 394 PEGLRKILNYIKNKYNNPTIYITENGFDDYENGTVT 429 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,362,433 Number of Sequences: 28952 Number of extensions: 247461 Number of successful extensions: 405 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 397 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 405 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1092379416 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -