BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0874 (463 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value L04753-1|AAA29357.1| 511|Anopheles gambiae alpha-amylase protein. 27 0.24 AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein. 23 6.9 X95912-1|CAA65156.1| 696|Anopheles gambiae immune factor protein. 22 9.1 DQ303468-1|ABC18327.1| 1115|Anopheles gambiae putative methopren... 22 9.1 AB090820-2|BAC57916.1| 1222|Anopheles gambiae reverse transcript... 22 9.1 >L04753-1|AAA29357.1| 511|Anopheles gambiae alpha-amylase protein. Length = 511 Score = 27.5 bits (58), Expect = 0.24 Identities = 14/31 (45%), Positives = 19/31 (61%) Frame = -1 Query: 424 GRAFGAHCAVPWVSWSRSGGARWGLVGSRSA 332 GRAFG + A+ W+S + G W L+ SR A Sbjct: 283 GRAFGGNDALRWLS---NFGEAWRLLASREA 310 >AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein. Length = 3320 Score = 22.6 bits (46), Expect = 6.9 Identities = 9/25 (36%), Positives = 12/25 (48%) Frame = +1 Query: 313 AREALAPQNDYRLNPIEPHHSDSTK 387 A + Q D ++NP HH TK Sbjct: 3044 ANQGKQDQEDRKVNPYLKHHKRQTK 3068 >X95912-1|CAA65156.1| 696|Anopheles gambiae immune factor protein. Length = 696 Score = 22.2 bits (45), Expect = 9.1 Identities = 9/21 (42%), Positives = 13/21 (61%), Gaps = 1/21 (4%) Frame = +1 Query: 331 PQNDYRLNPIEP-HHSDSTKP 390 P N Y+L P++P + ST P Sbjct: 423 PSNQYQLQPMQPMFTAQSTSP 443 >DQ303468-1|ABC18327.1| 1115|Anopheles gambiae putative methoprene-tolerant protein protein. Length = 1115 Score = 22.2 bits (45), Expect = 9.1 Identities = 10/30 (33%), Positives = 15/30 (50%) Frame = +3 Query: 360 RAPPLRLHETHGTAQCAPKARPYPVPILLI 449 R PPL + + T +P PVP+ L+ Sbjct: 826 RVPPLPNSQHYFTQPFSPSGGTTPVPVSLL 855 >AB090820-2|BAC57916.1| 1222|Anopheles gambiae reverse transcriptase protein. Length = 1222 Score = 22.2 bits (45), Expect = 9.1 Identities = 8/14 (57%), Positives = 9/14 (64%) Frame = +1 Query: 376 DSTKPTVPHSARRR 417 + T PTVPH RR Sbjct: 1153 EGTLPTVPHGRNRR 1166 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 422,301 Number of Sequences: 2352 Number of extensions: 7040 Number of successful extensions: 19 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 19 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 19 length of database: 563,979 effective HSP length: 59 effective length of database: 425,211 effective search space used: 39969834 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -