BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0873 (470 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC045549-1|AAH45549.1| 1380|Homo sapiens carboxypeptidase D prot... 39 0.008 U65090-1|AAC51775.2| 1380|Homo sapiens carboxypeptidase D protein. 39 0.010 D85390-1|BAA33370.1| 1380|Homo sapiens gp180-carboxypeptidase D-... 39 0.010 BC051702-1|AAH51702.1| 1380|Homo sapiens carboxypeptidase D prot... 39 0.010 BC045624-1|AAH45624.1| 1380|Homo sapiens carboxypeptidase D prot... 39 0.010 X14329-1|CAA32507.1| 458|Homo sapiens protein ( Human mRNA for ... 36 0.094 BC027897-1|AAH27897.1| 458|Homo sapiens carboxypeptidase N, pol... 36 0.094 AL441886-3|CAI13078.1| 458|Homo sapiens carboxypeptidase N, pol... 36 0.094 J04970-1|AAA35651.2| 443|Homo sapiens carboxypeptidase M precur... 30 4.6 BC022276-1|AAH22276.1| 443|Homo sapiens carboxypeptidase M prot... 30 4.6 AF368463-1|AAK69717.1| 443|Homo sapiens carboxypeptidase M prot... 30 4.6 AF262947-1|AAG47641.1| 443|Homo sapiens carboxypeptidase M prot... 30 4.6 >BC045549-1|AAH45549.1| 1380|Homo sapiens carboxypeptidase D protein. Length = 1380 Score = 39.1 bits (87), Expect = 0.008 Identities = 27/98 (27%), Positives = 49/98 (50%) Frame = +3 Query: 174 SHVDTAVFSNNRQSTSFSSHK*GRILSKTSNYTKYDQLGILFDKLESTYPDLAKVYSIGE 353 S T N TS SS++ I K ++ + + I + + YP++ ++YS+G+ Sbjct: 475 STASTVAIPNILSGTS-SSYQ--PIQPKDFHHHNFPDMEIFLRRFANEYPNITRLYSLGK 531 Query: 354 FPSKVGKLLVLQITQDVQNEHPERPAFKIPLANMHGDE 467 + +L V++I+ + P P FK + NMHG+E Sbjct: 532 -SVESRELYVMEISDNPGVHEPGEPEFKY-IGNMHGNE 567 >U65090-1|AAC51775.2| 1380|Homo sapiens carboxypeptidase D protein. Length = 1380 Score = 38.7 bits (86), Expect = 0.010 Identities = 27/98 (27%), Positives = 49/98 (50%) Frame = +3 Query: 174 SHVDTAVFSNNRQSTSFSSHK*GRILSKTSNYTKYDQLGILFDKLESTYPDLAKVYSIGE 353 S T N TS SS++ I K ++ + + I + + YP++ ++YS+G+ Sbjct: 475 STASTVAIPNILSGTS-SSYQ--PIQPKDFHHHHFPDMEIFLRRFANEYPNITRLYSLGK 531 Query: 354 FPSKVGKLLVLQITQDVQNEHPERPAFKIPLANMHGDE 467 + +L V++I+ + P P FK + NMHG+E Sbjct: 532 -SVESRELYVMEISDNPGVHEPGEPEFKY-IGNMHGNE 567 >D85390-1|BAA33370.1| 1380|Homo sapiens gp180-carboxypeptidase D-like enzyme protein. Length = 1380 Score = 38.7 bits (86), Expect = 0.010 Identities = 27/98 (27%), Positives = 49/98 (50%) Frame = +3 Query: 174 SHVDTAVFSNNRQSTSFSSHK*GRILSKTSNYTKYDQLGILFDKLESTYPDLAKVYSIGE 353 S T N TS SS++ I K ++ + + I + + YP++ ++YS+G+ Sbjct: 475 STASTVAIPNILSGTS-SSYQ--PIQPKDFHHHHFPDMEIFLRRFANEYPNITRLYSLGK 531 Query: 354 FPSKVGKLLVLQITQDVQNEHPERPAFKIPLANMHGDE 467 + +L V++I+ + P P FK + NMHG+E Sbjct: 532 -SVESRELYVMEISDNPGVHEPGEPEFKY-IGNMHGNE 567 >BC051702-1|AAH51702.1| 1380|Homo sapiens carboxypeptidase D protein. Length = 1380 Score = 38.7 bits (86), Expect = 0.010 Identities = 27/98 (27%), Positives = 49/98 (50%) Frame = +3 Query: 174 SHVDTAVFSNNRQSTSFSSHK*GRILSKTSNYTKYDQLGILFDKLESTYPDLAKVYSIGE 353 S T N TS SS++ I K ++ + + I + + YP++ ++YS+G+ Sbjct: 475 STASTVAIPNILSGTS-SSYQ--PIQPKDFHHHHFPDMEIFLRRFANEYPNITRLYSLGK 531 Query: 354 FPSKVGKLLVLQITQDVQNEHPERPAFKIPLANMHGDE 467 + +L V++I+ + P P FK + NMHG+E Sbjct: 532 -SVESRELYVMEISDNPGVHEPGEPEFKY-IGNMHGNE 567 >BC045624-1|AAH45624.1| 1380|Homo sapiens carboxypeptidase D protein. Length = 1380 Score = 38.7 bits (86), Expect = 0.010 Identities = 27/98 (27%), Positives = 49/98 (50%) Frame = +3 Query: 174 SHVDTAVFSNNRQSTSFSSHK*GRILSKTSNYTKYDQLGILFDKLESTYPDLAKVYSIGE 353 S T N TS SS++ I K ++ + + I + + YP++ ++YS+G+ Sbjct: 475 STASTVAIPNILSGTS-SSYQ--PIQPKDFHHHHFPDMEIFLRRFANEYPNITRLYSLGK 531 Query: 354 FPSKVGKLLVLQITQDVQNEHPERPAFKIPLANMHGDE 467 + +L V++I+ + P P FK + NMHG+E Sbjct: 532 -SVESRELYVMEISDNPGVHEPGEPEFKY-IGNMHGNE 567 >X14329-1|CAA32507.1| 458|Homo sapiens protein ( Human mRNA for carboxypeptidase N small subunit (EC 3.4.17.3). ). Length = 458 Score = 35.5 bits (78), Expect = 0.094 Identities = 24/72 (33%), Positives = 37/72 (51%), Gaps = 1/72 (1%) Frame = +3 Query: 258 TSNYTKYDQLGILFDKLESTYPDLAKVYSIGEFPSKVGK-LLVLQITQDVQNEHPERPAF 434 T + +YD L K+++ P + +VYSIG S G+ L VL+ + P P Sbjct: 22 TFRHHRYDDLVRTLYKVQNECPGITRVYSIGR--SVEGRHLYVLEFSDHPGIHEPLEPEV 79 Query: 435 KIPLANMHGDES 470 K + NMHG+E+ Sbjct: 80 KY-VGNMHGNEA 90 >BC027897-1|AAH27897.1| 458|Homo sapiens carboxypeptidase N, polypeptide 1 protein. Length = 458 Score = 35.5 bits (78), Expect = 0.094 Identities = 24/72 (33%), Positives = 37/72 (51%), Gaps = 1/72 (1%) Frame = +3 Query: 258 TSNYTKYDQLGILFDKLESTYPDLAKVYSIGEFPSKVGK-LLVLQITQDVQNEHPERPAF 434 T + +YD L K+++ P + +VYSIG S G+ L VL+ + P P Sbjct: 22 TFRHHRYDDLVRTLYKVQNECPGITRVYSIGR--SVEGRHLYVLEFSDHPGIHEPLEPEV 79 Query: 435 KIPLANMHGDES 470 K + NMHG+E+ Sbjct: 80 KY-VGNMHGNEA 90 >AL441886-3|CAI13078.1| 458|Homo sapiens carboxypeptidase N, polypeptide 1 protein. Length = 458 Score = 35.5 bits (78), Expect = 0.094 Identities = 24/72 (33%), Positives = 37/72 (51%), Gaps = 1/72 (1%) Frame = +3 Query: 258 TSNYTKYDQLGILFDKLESTYPDLAKVYSIGEFPSKVGK-LLVLQITQDVQNEHPERPAF 434 T + +YD L K+++ P + +VYSIG S G+ L VL+ + P P Sbjct: 22 TFRHHRYDDLVRTLYKVQNECPGITRVYSIGR--SVEGRHLYVLEFSDHPGIHEPLEPEV 79 Query: 435 KIPLANMHGDES 470 K + NMHG+E+ Sbjct: 80 KY-VGNMHGNEA 90 >J04970-1|AAA35651.2| 443|Homo sapiens carboxypeptidase M precursor protein. Length = 443 Score = 29.9 bits (64), Expect = 4.6 Identities = 21/70 (30%), Positives = 34/70 (48%), Gaps = 1/70 (1%) Frame = +3 Query: 264 NYTKYDQLGILFDKLESTYPDLAKVYSIGEFPSKVGKLLVLQITQDVQNEHPER-PAFKI 440 NY + + + + Y + ++SIG+ S G+ L + + EH P FK Sbjct: 21 NYHRQEGMEAFLKTVAQNYSSVTHLHSIGK--SVKGRNLWVLVVGRFPKEHRIGIPEFKY 78 Query: 441 PLANMHGDES 470 +ANMHGDE+ Sbjct: 79 -VANMHGDET 87 >BC022276-1|AAH22276.1| 443|Homo sapiens carboxypeptidase M protein. Length = 443 Score = 29.9 bits (64), Expect = 4.6 Identities = 21/70 (30%), Positives = 34/70 (48%), Gaps = 1/70 (1%) Frame = +3 Query: 264 NYTKYDQLGILFDKLESTYPDLAKVYSIGEFPSKVGKLLVLQITQDVQNEHPER-PAFKI 440 NY + + + + Y + ++SIG+ S G+ L + + EH P FK Sbjct: 21 NYHRQEGMEAFLKTVAQNYSSVTHLHSIGK--SVKGRNLWVLVVGRFPKEHRIGIPEFKY 78 Query: 441 PLANMHGDES 470 +ANMHGDE+ Sbjct: 79 -VANMHGDET 87 >AF368463-1|AAK69717.1| 443|Homo sapiens carboxypeptidase M protein. Length = 443 Score = 29.9 bits (64), Expect = 4.6 Identities = 21/70 (30%), Positives = 34/70 (48%), Gaps = 1/70 (1%) Frame = +3 Query: 264 NYTKYDQLGILFDKLESTYPDLAKVYSIGEFPSKVGKLLVLQITQDVQNEHPER-PAFKI 440 NY + + + + Y + ++SIG+ S G+ L + + EH P FK Sbjct: 21 NYHRQEGMEAFLKTVAQNYSSVTHLHSIGK--SVKGRNLWVLVVGRFPKEHRIGIPEFKY 78 Query: 441 PLANMHGDES 470 +ANMHGDE+ Sbjct: 79 -VANMHGDET 87 >AF262947-1|AAG47641.1| 443|Homo sapiens carboxypeptidase M protein. Length = 443 Score = 29.9 bits (64), Expect = 4.6 Identities = 21/70 (30%), Positives = 34/70 (48%), Gaps = 1/70 (1%) Frame = +3 Query: 264 NYTKYDQLGILFDKLESTYPDLAKVYSIGEFPSKVGKLLVLQITQDVQNEHPER-PAFKI 440 NY + + + + Y + ++SIG+ S G+ L + + EH P FK Sbjct: 21 NYHRQEGMEAFLKTVAQNYSSVTHLHSIGK--SVKGRNLWVLVVGRFPKEHRIGIPEFKY 78 Query: 441 PLANMHGDES 470 +ANMHGDE+ Sbjct: 79 -VANMHGDET 87 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 66,459,352 Number of Sequences: 237096 Number of extensions: 1363191 Number of successful extensions: 2973 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 2830 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2959 length of database: 76,859,062 effective HSP length: 84 effective length of database: 56,942,998 effective search space used: 4099895856 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -