BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0871 (502 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 06_01_0392 - 2815440-2815659,2815856-2816052 27 6.4 01_01_0451 + 3355782-3355823,3356410-3357222 27 6.4 05_01_0367 - 2874429-2874483,2876274-2876345,2876453-2879613,287... 27 8.5 >06_01_0392 - 2815440-2815659,2815856-2816052 Length = 138 Score = 27.5 bits (58), Expect = 6.4 Identities = 15/44 (34%), Positives = 20/44 (45%) Frame = -3 Query: 140 RPLIDLPQIALNSLHCIH*IGGTLSNSNTISQRFFYCLDGWTSL 9 R LID ++ L L H G S T+ Q+F +D W L Sbjct: 4 RELIDRDKLVLIDLQ-FHGFHGVKSEEKTLGQKFVVDVDAWMDL 46 >01_01_0451 + 3355782-3355823,3356410-3357222 Length = 284 Score = 27.5 bits (58), Expect = 6.4 Identities = 13/48 (27%), Positives = 24/48 (50%) Frame = +2 Query: 14 SSNHLSNKKTAEKLCWNWKGSPQSSECNVMNLMQFEAGQLTVSLRGPS 157 +S+ + K ++K C KG P++S C + Q G+ +R P+ Sbjct: 58 NSSRKAPAKGSKKGCMAGKGGPENSNCAYRGVRQRTWGKWVAEIREPN 105 >05_01_0367 - 2874429-2874483,2876274-2876345,2876453-2879613, 2879715-2879973,2880060-2880346,2880423-2880758, 2880862-2881003,2881077-2881297,2881379-2881540, 2881617-2881775,2881860-2882159,2882834-2883097, 2883133-2883243,2883902-2883988 Length = 1871 Score = 27.1 bits (57), Expect = 8.5 Identities = 12/25 (48%), Positives = 15/25 (60%) Frame = +1 Query: 424 TSVPLSTTLPDYSLLRTVYKKSSPL 498 TS+P S T P YS +Y SSP+ Sbjct: 1637 TSLPHSPTSPIYSATSPIYSPSSPI 1661 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,982,659 Number of Sequences: 37544 Number of extensions: 106356 Number of successful extensions: 219 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 215 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 219 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1059318940 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -