BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0869 (608 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB196633-1|BAE53435.1| 1857|Homo sapiens C8orfK23 protein protein. 31 4.2 >AB196633-1|BAE53435.1| 1857|Homo sapiens C8orfK23 protein protein. Length = 1857 Score = 30.7 bits (66), Expect = 4.2 Identities = 17/49 (34%), Positives = 24/49 (48%), Gaps = 1/49 (2%) Frame = +2 Query: 263 RITIHWP-SFYNVVTGKTLALPNLIALQHIPLSPAGVIAKRPAPIALPN 406 R+ WP S +TGK A +L+ + +P G K P P+A PN Sbjct: 1749 RVRGWWPFSKSKELTGKVEAEFHLVTAEEAEKNPVGKARKEPEPLAKPN 1797 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 91,154,045 Number of Sequences: 237096 Number of extensions: 1905745 Number of successful extensions: 6940 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 6860 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6940 length of database: 76,859,062 effective HSP length: 87 effective length of database: 56,231,710 effective search space used: 6466646650 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -