BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= ce--0869
(608 letters)
Database: human
237,096 sequences; 76,859,062 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
AB196633-1|BAE53435.1| 1857|Homo sapiens C8orfK23 protein protein. 31 4.2
>AB196633-1|BAE53435.1| 1857|Homo sapiens C8orfK23 protein protein.
Length = 1857
Score = 30.7 bits (66), Expect = 4.2
Identities = 17/49 (34%), Positives = 24/49 (48%), Gaps = 1/49 (2%)
Frame = +2
Query: 263 RITIHWP-SFYNVVTGKTLALPNLIALQHIPLSPAGVIAKRPAPIALPN 406
R+ WP S +TGK A +L+ + +P G K P P+A PN
Sbjct: 1749 RVRGWWPFSKSKELTGKVEAEFHLVTAEEAEKNPVGKARKEPEPLAKPN 1797
Database: human
Posted date: Oct 23, 2007 1:18 PM
Number of letters in database: 76,859,062
Number of sequences in database: 237,096
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 91,154,045
Number of Sequences: 237096
Number of extensions: 1905745
Number of successful extensions: 6940
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 6860
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 6940
length of database: 76,859,062
effective HSP length: 87
effective length of database: 56,231,710
effective search space used: 6466646650
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -