BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0869 (608 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g18760.1 68415.m02184 SNF2 domain-containing protein / helica... 27 7.4 At1g27020.1 68414.m03294 expressed protein 27 7.4 >At2g18760.1 68415.m02184 SNF2 domain-containing protein / helicase domain-containing protein similar to SP|Q03468 Excision repair protein ERCC-6 (Cockayne syndrome protein CSB) {Homo sapiens}; contains PFam profiles PF00271: Helicase conserved C-terminal domain, PF00176: SNF2 family N-terminal domain Length = 1187 Score = 27.5 bits (58), Expect = 7.4 Identities = 15/56 (26%), Positives = 25/56 (44%) Frame = +2 Query: 248 SPLVSRITIHWPSFYNVVTGKTLALPNLIALQHIPLSPAGVIAKRPAPIALPNSCA 415 +P+ +++T W F V GK LP A +P++ G P ++ CA Sbjct: 575 APIQNKLTELWSLFDFVFPGKLGVLPVFEAEFSVPITVGGYANASPLQVSTAYRCA 630 >At1g27020.1 68414.m03294 expressed protein Length = 308 Score = 27.5 bits (58), Expect = 7.4 Identities = 10/21 (47%), Positives = 12/21 (57%) Frame = +1 Query: 304 WENPGVTQLNRLAAHPPFASW 366 WE P T N+LA FA+W Sbjct: 163 WEKPTSTDFNQLAKESEFAAW 183 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,289,587 Number of Sequences: 28952 Number of extensions: 264279 Number of successful extensions: 543 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 533 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 543 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1216725696 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -