BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0864 (638 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ535208-1|CAD59408.1| 1133|Anopheles gambiae SMC6 protein protein. 23 6.2 AB090816-2|BAC57908.1| 1201|Anopheles gambiae reverse transcript... 23 6.2 AY341217-1|AAR13781.1| 200|Anopheles gambiae SRPN10 protein. 23 8.2 AY341216-1|AAR13780.1| 200|Anopheles gambiae SRPN10 protein. 23 8.2 AF043443-1|AAC05668.1| 232|Anopheles gambiae putative pupal-spe... 23 8.2 AF043442-1|AAC05667.1| 231|Anopheles gambiae putative pupal-spe... 23 8.2 AF043441-1|AAC05666.1| 231|Anopheles gambiae putative pupal-spe... 23 8.2 AF043440-1|AAC05665.1| 234|Anopheles gambiae putative pupal-spe... 23 8.2 AF043439-1|AAC05664.1| 239|Anopheles gambiae putative pupal-spe... 23 8.2 AF043438-1|AAC05663.1| 231|Anopheles gambiae putative pupal-spe... 23 8.2 AF043437-1|AAC05662.1| 239|Anopheles gambiae putative pupal-spe... 23 8.2 AF043436-1|AAC05661.1| 263|Anopheles gambiae putative pupal-spe... 23 8.2 AF043435-1|AAC05660.1| 231|Anopheles gambiae pupal-specific cut... 23 8.2 AF043434-1|AAC05659.1| 232|Anopheles gambiae putative pupal-spe... 23 8.2 AF043433-3|AAC05658.1| 231|Anopheles gambiae putative pupal-spe... 23 8.2 AF043433-2|AAC05657.1| 239|Anopheles gambiae putative pupal-spe... 23 8.2 AF043433-1|AAC05656.1| 231|Anopheles gambiae putative pupal-spe... 23 8.2 AB090823-2|BAC57922.1| 1154|Anopheles gambiae reverse transcript... 23 8.2 >AJ535208-1|CAD59408.1| 1133|Anopheles gambiae SMC6 protein protein. Length = 1133 Score = 23.4 bits (48), Expect = 6.2 Identities = 13/47 (27%), Positives = 24/47 (51%) Frame = +2 Query: 317 LHKYIDMRHKQLGPIFYERLTGKTKLVFISDPTHMKSLFLNLEGKYP 457 L +YI++R+K+ I L G F+S ++L L+ ++P Sbjct: 546 LGQYIEVRNKKWSGIVETALGGCLSAFFVSTQEDWRTLDALLKREFP 592 >AB090816-2|BAC57908.1| 1201|Anopheles gambiae reverse transcriptase protein. Length = 1201 Score = 23.4 bits (48), Expect = 6.2 Identities = 11/35 (31%), Positives = 15/35 (42%) Frame = +1 Query: 295 FCRWRKKLTQIYRHASQAIRTYILREINRKDKTCL 399 F R R ++ I R + R N +DK CL Sbjct: 605 FRRGRSTISAIQRVVDAGTAAKLFRRTNTRDKRCL 639 >AY341217-1|AAR13781.1| 200|Anopheles gambiae SRPN10 protein. Length = 200 Score = 23.0 bits (47), Expect = 8.2 Identities = 7/30 (23%), Positives = 15/30 (50%) Frame = -1 Query: 128 IKEDPDISNHFNKPRTQCGNGSWKTKRDFI 39 + P+I+NH ++P+ + S F+ Sbjct: 29 LSTQPEITNHLDRPKVTMADNSSSLDAQFV 58 >AY341216-1|AAR13780.1| 200|Anopheles gambiae SRPN10 protein. Length = 200 Score = 23.0 bits (47), Expect = 8.2 Identities = 7/30 (23%), Positives = 15/30 (50%) Frame = -1 Query: 128 IKEDPDISNHFNKPRTQCGNGSWKTKRDFI 39 + P+I+NH ++P+ + S F+ Sbjct: 29 LSTQPEITNHLDRPKVTMADNSSSLDAQFV 58 >AF043443-1|AAC05668.1| 232|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 232 Score = 23.0 bits (47), Expect = 8.2 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = -3 Query: 564 IIRRLIQPILSVHKEKSSFDPYNFSYSTH 478 I++ + QP + E + Y FSYS H Sbjct: 71 IVKTIAQPTIIKSVEHHAPANYEFSYSVH 99 >AF043442-1|AAC05667.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2c protein. Length = 231 Score = 23.0 bits (47), Expect = 8.2 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = -3 Query: 564 IIRRLIQPILSVHKEKSSFDPYNFSYSTH 478 I++ + QP + E + Y FSYS H Sbjct: 63 IVKTIAQPTIIKSVEHHAPANYEFSYSVH 91 >AF043441-1|AAC05666.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 231 Score = 23.0 bits (47), Expect = 8.2 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = -3 Query: 564 IIRRLIQPILSVHKEKSSFDPYNFSYSTH 478 I++ + QP + E + Y FSYS H Sbjct: 63 IVKTIAQPTIIKSVEHHAPANYEFSYSVH 91 >AF043440-1|AAC05665.1| 234|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 234 Score = 23.0 bits (47), Expect = 8.2 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = -3 Query: 564 IIRRLIQPILSVHKEKSSFDPYNFSYSTH 478 I++ + QP + E + Y FSYS H Sbjct: 63 IVKTIAQPTIIKSVEHHAPANYEFSYSVH 91 >AF043439-1|AAC05664.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 239 Score = 23.0 bits (47), Expect = 8.2 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = -3 Query: 564 IIRRLIQPILSVHKEKSSFDPYNFSYSTH 478 I++ + QP + E + Y FSYS H Sbjct: 71 IVKTIAQPTIIKSVEHHAPANYEFSYSVH 99 >AF043438-1|AAC05663.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 231 Score = 23.0 bits (47), Expect = 8.2 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = -3 Query: 564 IIRRLIQPILSVHKEKSSFDPYNFSYSTH 478 I++ + QP + E + Y FSYS H Sbjct: 63 IVKTIAQPTIIKSVEHHAPANYEFSYSVH 91 >AF043437-1|AAC05662.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 239 Score = 23.0 bits (47), Expect = 8.2 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = -3 Query: 564 IIRRLIQPILSVHKEKSSFDPYNFSYSTH 478 I++ + QP + E + Y FSYS H Sbjct: 71 IVKTIAQPTIIKSVEHHAPANYEFSYSVH 99 >AF043436-1|AAC05661.1| 263|Anopheles gambiae putative pupal-specific cuticular proteinCP2c protein. Length = 263 Score = 23.0 bits (47), Expect = 8.2 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = -3 Query: 564 IIRRLIQPILSVHKEKSSFDPYNFSYSTH 478 I++ + QP + E + Y FSYS H Sbjct: 95 IVKTIAQPTIIKSVEHHAPANYEFSYSVH 123 >AF043435-1|AAC05660.1| 231|Anopheles gambiae pupal-specific cuticular protein CP2b protein. Length = 231 Score = 23.0 bits (47), Expect = 8.2 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = -3 Query: 564 IIRRLIQPILSVHKEKSSFDPYNFSYSTH 478 I++ + QP + E + Y FSYS H Sbjct: 63 IVKTIAQPTIIKSVEHHAPANYEFSYSVH 91 >AF043434-1|AAC05659.1| 232|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 232 Score = 23.0 bits (47), Expect = 8.2 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = -3 Query: 564 IIRRLIQPILSVHKEKSSFDPYNFSYSTH 478 I++ + QP + E + Y FSYS H Sbjct: 71 IVKTIAQPTIIKSVEHHAPANYEFSYSVH 99 >AF043433-3|AAC05658.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 231 Score = 23.0 bits (47), Expect = 8.2 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = -3 Query: 564 IIRRLIQPILSVHKEKSSFDPYNFSYSTH 478 I++ + QP + E + Y FSYS H Sbjct: 63 IVKTIAQPTIIKSVEHHAPANYEFSYSVH 91 >AF043433-2|AAC05657.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 239 Score = 23.0 bits (47), Expect = 8.2 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = -3 Query: 564 IIRRLIQPILSVHKEKSSFDPYNFSYSTH 478 I++ + QP + E + Y FSYS H Sbjct: 71 IVKTIAQPTIIKSVEHHAPANYEFSYSVH 99 >AF043433-1|AAC05656.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 231 Score = 23.0 bits (47), Expect = 8.2 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = -3 Query: 564 IIRRLIQPILSVHKEKSSFDPYNFSYSTH 478 I++ + QP + E + Y FSYS H Sbjct: 63 IVKTIAQPTIIKSVEHHAPANYEFSYSVH 91 >AB090823-2|BAC57922.1| 1154|Anopheles gambiae reverse transcriptase protein. Length = 1154 Score = 23.0 bits (47), Expect = 8.2 Identities = 12/35 (34%), Positives = 14/35 (40%) Frame = +1 Query: 295 FCRWRKKLTQIYRHASQAIRTYILREINRKDKTCL 399 F R R + I R R R N +DK CL Sbjct: 544 FRRGRSTFSAIQRVVDAGRRAKSFRRTNHRDKRCL 578 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 705,576 Number of Sequences: 2352 Number of extensions: 14277 Number of successful extensions: 49 Number of sequences better than 10.0: 18 Number of HSP's better than 10.0 without gapping: 48 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 49 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 62723250 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -