BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0864 (638 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ468657-1|ABE02558.1| 322|Apis mellifera 1,4,5-trisphosphate r... 24 1.1 AB006152-1|BAA24504.1| 178|Apis mellifera inositol 1,4,5-tripho... 24 1.1 AM076717-1|CAJ28210.1| 501|Apis mellifera serotonin receptor pr... 23 2.5 AY500239-1|AAR92109.1| 555|Apis mellifera neuronal nicotinic ac... 22 5.8 DQ026034-1|AAY87893.1| 569|Apis mellifera nicotinic acetylcholi... 21 7.6 DQ026033-1|AAY87892.1| 569|Apis mellifera nicotinic acetylcholi... 21 7.6 AY588474-1|AAT94401.1| 104|Apis mellifera defensin 2 protein. 21 7.6 AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter... 21 7.6 AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter... 21 7.6 >DQ468657-1|ABE02558.1| 322|Apis mellifera 1,4,5-trisphosphate receptor protein. Length = 322 Score = 24.2 bits (50), Expect = 1.1 Identities = 8/19 (42%), Positives = 14/19 (73%) Frame = +3 Query: 105 TYIRILFNLKMHRFPSMSS 161 T++R+L +L MH +P + S Sbjct: 126 TFLRVLLHLAMHDYPPLVS 144 >AB006152-1|BAA24504.1| 178|Apis mellifera inositol 1,4,5-triphosphate recepter protein. Length = 178 Score = 24.2 bits (50), Expect = 1.1 Identities = 8/19 (42%), Positives = 14/19 (73%) Frame = +3 Query: 105 TYIRILFNLKMHRFPSMSS 161 T++R+L +L MH +P + S Sbjct: 94 TFLRVLLHLAMHDYPPLVS 112 >AM076717-1|CAJ28210.1| 501|Apis mellifera serotonin receptor protein. Length = 501 Score = 23.0 bits (47), Expect = 2.5 Identities = 11/30 (36%), Positives = 18/30 (60%), Gaps = 1/30 (3%) Frame = +3 Query: 147 PSMSSIRSAVRSRNSNRCSMSTKPH-KSLR 233 P S+ + VR+ ++ CS++ PH K LR Sbjct: 332 PMTSTKSTIVRNHLNSTCSVTNSPHQKKLR 361 >AY500239-1|AAR92109.1| 555|Apis mellifera neuronal nicotinic acetylcholine receptoralpha7-1 protein. Length = 555 Score = 21.8 bits (44), Expect = 5.8 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = -2 Query: 97 LINREHNAATVPGKLNEILFYSAKP 23 + N E + VPGK NEI +Y+ P Sbjct: 192 ITNGEWDLLGVPGKRNEI-YYNCCP 215 >DQ026034-1|AAY87893.1| 569|Apis mellifera nicotinic acetylcholine receptor alpha4subunit protein. Length = 569 Score = 21.4 bits (43), Expect = 7.6 Identities = 8/22 (36%), Positives = 14/22 (63%), Gaps = 1/22 (4%) Frame = +1 Query: 361 ILREINRKDKTCLY-QRPNSHE 423 ++R + K+KTC Y P++ E Sbjct: 377 LMRTVRGKEKTCYYPYHPSTQE 398 >DQ026033-1|AAY87892.1| 569|Apis mellifera nicotinic acetylcholine receptor alpha4subunit protein. Length = 569 Score = 21.4 bits (43), Expect = 7.6 Identities = 8/22 (36%), Positives = 14/22 (63%), Gaps = 1/22 (4%) Frame = +1 Query: 361 ILREINRKDKTCLY-QRPNSHE 423 ++R + K+KTC Y P++ E Sbjct: 377 LMRTVRGKEKTCYYPYHPSTQE 398 >AY588474-1|AAT94401.1| 104|Apis mellifera defensin 2 protein. Length = 104 Score = 21.4 bits (43), Expect = 7.6 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = +1 Query: 97 KWLLISGSSLI*KCIVSRR 153 KWL I+ S+ +C+ RR Sbjct: 72 KWLSINHSACAIRCLAQRR 90 >AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 593 Score = 21.4 bits (43), Expect = 7.6 Identities = 9/24 (37%), Positives = 14/24 (58%) Frame = -1 Query: 107 SNHFNKPRTQCGNGSWKTKRDFIL 36 S+ F + +T G W +K +FIL Sbjct: 7 SSAFKEIKTLPDRGMWSSKIEFIL 30 >AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 646 Score = 21.4 bits (43), Expect = 7.6 Identities = 9/24 (37%), Positives = 14/24 (58%) Frame = -1 Query: 107 SNHFNKPRTQCGNGSWKTKRDFIL 36 S+ F + +T G W +K +FIL Sbjct: 60 SSAFKEIKTLPDRGMWSSKIEFIL 83 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 192,900 Number of Sequences: 438 Number of extensions: 4344 Number of successful extensions: 12 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 19193721 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -