BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0863 (671 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF043443-1|AAC05668.1| 232|Anopheles gambiae putative pupal-spe... 52 1e-08 AF043442-1|AAC05667.1| 231|Anopheles gambiae putative pupal-spe... 52 1e-08 AF043441-1|AAC05666.1| 231|Anopheles gambiae putative pupal-spe... 52 1e-08 AF043440-1|AAC05665.1| 234|Anopheles gambiae putative pupal-spe... 52 1e-08 AF043438-1|AAC05663.1| 231|Anopheles gambiae putative pupal-spe... 52 1e-08 AF043437-1|AAC05662.1| 239|Anopheles gambiae putative pupal-spe... 52 1e-08 AF043436-1|AAC05661.1| 263|Anopheles gambiae putative pupal-spe... 52 1e-08 AF043435-1|AAC05660.1| 231|Anopheles gambiae pupal-specific cut... 52 1e-08 AF043434-1|AAC05659.1| 232|Anopheles gambiae putative pupal-spe... 52 1e-08 AF043433-3|AAC05658.1| 231|Anopheles gambiae putative pupal-spe... 52 1e-08 AF043433-2|AAC05657.1| 239|Anopheles gambiae putative pupal-spe... 52 1e-08 AF043439-1|AAC05664.1| 239|Anopheles gambiae putative pupal-spe... 52 2e-08 AF043433-1|AAC05656.1| 231|Anopheles gambiae putative pupal-spe... 52 2e-08 U50469-1|AAA93473.1| 160|Anopheles gambiae protein ( Anopheles ... 51 3e-08 AF364132-1|AAL35508.1| 397|Anopheles gambiae putative odorant r... 26 1.2 EF382662-1|ABN54495.1| 178|Anopheles gambiae CPF family cuticle... 25 2.9 AB090817-1|BAC57909.1| 344|Anopheles gambiae gag-like protein p... 24 3.8 AB097148-2|BAC82628.1| 1077|Anopheles gambiae pol-like protein p... 24 5.0 AY341195-1|AAR13759.1| 294|Anopheles gambiae laminin protein. 23 8.8 AY341194-1|AAR13758.1| 294|Anopheles gambiae laminin protein. 23 8.8 AY341193-1|AAR13757.1| 294|Anopheles gambiae laminin protein. 23 8.8 AY341192-1|AAR13756.1| 294|Anopheles gambiae laminin protein. 23 8.8 AJ271193-1|CAB66001.1| 1623|Anopheles gambiae laminin gamma 1 pr... 23 8.8 >AF043443-1|AAC05668.1| 232|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 232 Score = 52.4 bits (120), Expect = 1e-08 Identities = 22/36 (61%), Positives = 29/36 (80%) Frame = +2 Query: 509 GDAVHGEYTLLEADGSVRKVEYTADDHHGFNAVVKQ 616 GD VHG+Y+LL++DG R V+Y AD H GFNAVV++ Sbjct: 115 GDEVHGQYSLLDSDGHQRIVDYHADHHTGFNAVVRR 150 Score = 41.1 bits (92), Expect = 3e-05 Identities = 17/29 (58%), Positives = 22/29 (75%) Frame = +3 Query: 420 EEYAHPKYDFAYSVADGHSGDNKSQHESR 506 E +A Y+F+YSV D H+GD KSQHE+R Sbjct: 85 EHHAPANYEFSYSVHDEHTGDIKSQHETR 113 Score = 23.4 bits (48), Expect = 6.6 Identities = 8/21 (38%), Positives = 11/21 (52%) Frame = +3 Query: 372 RVIAPAHKVLVAGHHEEEYAH 434 ++ P HKV+ H YAH Sbjct: 156 KIAQPVHKVIAQPVHVSSYAH 176 >AF043442-1|AAC05667.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2c protein. Length = 231 Score = 52.4 bits (120), Expect = 1e-08 Identities = 22/36 (61%), Positives = 29/36 (80%) Frame = +2 Query: 509 GDAVHGEYTLLEADGSVRKVEYTADDHHGFNAVVKQ 616 GD VHG+Y+LL++DG R V+Y AD H GFNAVV++ Sbjct: 107 GDEVHGQYSLLDSDGHQRIVDYHADHHTGFNAVVRR 142 Score = 41.1 bits (92), Expect = 3e-05 Identities = 17/29 (58%), Positives = 22/29 (75%) Frame = +3 Query: 420 EEYAHPKYDFAYSVADGHSGDNKSQHESR 506 E +A Y+F+YSV D H+GD KSQHE+R Sbjct: 77 EHHAPANYEFSYSVHDEHTGDIKSQHETR 105 Score = 24.2 bits (50), Expect = 3.8 Identities = 8/21 (38%), Positives = 11/21 (52%) Frame = +3 Query: 372 RVIAPAHKVLVAGHHEEEYAH 434 ++ P HKV+ H YAH Sbjct: 148 KIAQPVHKVIAQNVHVSSYAH 168 >AF043441-1|AAC05666.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 231 Score = 52.4 bits (120), Expect = 1e-08 Identities = 22/36 (61%), Positives = 29/36 (80%) Frame = +2 Query: 509 GDAVHGEYTLLEADGSVRKVEYTADDHHGFNAVVKQ 616 GD VHG+Y+LL++DG R V+Y AD H GFNAVV++ Sbjct: 107 GDEVHGQYSLLDSDGHQRIVDYHADHHTGFNAVVRR 142 Score = 41.1 bits (92), Expect = 3e-05 Identities = 17/29 (58%), Positives = 22/29 (75%) Frame = +3 Query: 420 EEYAHPKYDFAYSVADGHSGDNKSQHESR 506 E +A Y+F+YSV D H+GD KSQHE+R Sbjct: 77 EHHAPANYEFSYSVHDEHTGDIKSQHETR 105 Score = 23.4 bits (48), Expect = 6.6 Identities = 8/21 (38%), Positives = 11/21 (52%) Frame = +3 Query: 372 RVIAPAHKVLVAGHHEEEYAH 434 ++ P HKV+ H YAH Sbjct: 148 KIAQPVHKVIAQPVHVSSYAH 168 >AF043440-1|AAC05665.1| 234|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 234 Score = 52.4 bits (120), Expect = 1e-08 Identities = 22/36 (61%), Positives = 29/36 (80%) Frame = +2 Query: 509 GDAVHGEYTLLEADGSVRKVEYTADDHHGFNAVVKQ 616 GD VHG+Y+LL++DG R V+Y AD H GFNAVV++ Sbjct: 107 GDEVHGQYSLLDSDGHQRIVDYHADHHTGFNAVVRR 142 Score = 41.1 bits (92), Expect = 3e-05 Identities = 17/29 (58%), Positives = 22/29 (75%) Frame = +3 Query: 420 EEYAHPKYDFAYSVADGHSGDNKSQHESR 506 E +A Y+F+YSV D H+GD KSQHE+R Sbjct: 77 EHHAPANYEFSYSVHDEHTGDIKSQHETR 105 >AF043438-1|AAC05663.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 231 Score = 52.4 bits (120), Expect = 1e-08 Identities = 22/36 (61%), Positives = 29/36 (80%) Frame = +2 Query: 509 GDAVHGEYTLLEADGSVRKVEYTADDHHGFNAVVKQ 616 GD VHG+Y+LL++DG R V+Y AD H GFNAVV++ Sbjct: 107 GDEVHGQYSLLDSDGHQRIVDYHADHHTGFNAVVRR 142 Score = 41.1 bits (92), Expect = 3e-05 Identities = 17/29 (58%), Positives = 22/29 (75%) Frame = +3 Query: 420 EEYAHPKYDFAYSVADGHSGDNKSQHESR 506 E +A Y+F+YSV D H+GD KSQHE+R Sbjct: 77 EHHAPANYEFSYSVHDEHTGDIKSQHETR 105 Score = 23.4 bits (48), Expect = 6.6 Identities = 8/21 (38%), Positives = 11/21 (52%) Frame = +3 Query: 372 RVIAPAHKVLVAGHHEEEYAH 434 ++ P HKV+ H YAH Sbjct: 148 KIAQPVHKVIAQPVHVSSYAH 168 >AF043437-1|AAC05662.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 239 Score = 52.4 bits (120), Expect = 1e-08 Identities = 22/36 (61%), Positives = 29/36 (80%) Frame = +2 Query: 509 GDAVHGEYTLLEADGSVRKVEYTADDHHGFNAVVKQ 616 GD VHG+Y+LL++DG R V+Y AD H GFNAVV++ Sbjct: 115 GDEVHGQYSLLDSDGHQRIVDYHADHHTGFNAVVRR 150 Score = 41.1 bits (92), Expect = 3e-05 Identities = 17/29 (58%), Positives = 22/29 (75%) Frame = +3 Query: 420 EEYAHPKYDFAYSVADGHSGDNKSQHESR 506 E +A Y+F+YSV D H+GD KSQHE+R Sbjct: 85 EHHAPANYEFSYSVHDEHTGDIKSQHETR 113 Score = 23.4 bits (48), Expect = 6.6 Identities = 8/21 (38%), Positives = 11/21 (52%) Frame = +3 Query: 372 RVIAPAHKVLVAGHHEEEYAH 434 ++ P HKV+ H YAH Sbjct: 156 KIAQPVHKVIAQPVHVSSYAH 176 >AF043436-1|AAC05661.1| 263|Anopheles gambiae putative pupal-specific cuticular proteinCP2c protein. Length = 263 Score = 52.4 bits (120), Expect = 1e-08 Identities = 22/36 (61%), Positives = 29/36 (80%) Frame = +2 Query: 509 GDAVHGEYTLLEADGSVRKVEYTADDHHGFNAVVKQ 616 GD VHG+Y+LL++DG R V+Y AD H GFNAVV++ Sbjct: 139 GDEVHGQYSLLDSDGHQRIVDYHADHHTGFNAVVRR 174 Score = 41.1 bits (92), Expect = 3e-05 Identities = 17/29 (58%), Positives = 22/29 (75%) Frame = +3 Query: 420 EEYAHPKYDFAYSVADGHSGDNKSQHESR 506 E +A Y+F+YSV D H+GD KSQHE+R Sbjct: 109 EHHAPANYEFSYSVHDEHTGDIKSQHETR 137 Score = 23.4 bits (48), Expect = 6.6 Identities = 8/21 (38%), Positives = 11/21 (52%) Frame = +3 Query: 372 RVIAPAHKVLVAGHHEEEYAH 434 ++ P HKV+ H YAH Sbjct: 180 KIAQPVHKVIAQPVHVSSYAH 200 >AF043435-1|AAC05660.1| 231|Anopheles gambiae pupal-specific cuticular protein CP2b protein. Length = 231 Score = 52.4 bits (120), Expect = 1e-08 Identities = 22/36 (61%), Positives = 29/36 (80%) Frame = +2 Query: 509 GDAVHGEYTLLEADGSVRKVEYTADDHHGFNAVVKQ 616 GD VHG+Y+LL++DG R V+Y AD H GFNAVV++ Sbjct: 107 GDEVHGQYSLLDSDGHQRIVDYHADHHTGFNAVVRR 142 Score = 41.1 bits (92), Expect = 3e-05 Identities = 17/29 (58%), Positives = 22/29 (75%) Frame = +3 Query: 420 EEYAHPKYDFAYSVADGHSGDNKSQHESR 506 E +A Y+F+YSV D H+GD KSQHE+R Sbjct: 77 EHHAPANYEFSYSVHDEHTGDIKSQHETR 105 Score = 23.4 bits (48), Expect = 6.6 Identities = 8/21 (38%), Positives = 11/21 (52%) Frame = +3 Query: 372 RVIAPAHKVLVAGHHEEEYAH 434 ++ P HKV+ H YAH Sbjct: 148 KIAQPVHKVIAQPVHVSSYAH 168 >AF043434-1|AAC05659.1| 232|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 232 Score = 52.4 bits (120), Expect = 1e-08 Identities = 22/36 (61%), Positives = 29/36 (80%) Frame = +2 Query: 509 GDAVHGEYTLLEADGSVRKVEYTADDHHGFNAVVKQ 616 GD VHG+Y+LL++DG R V+Y AD H GFNAVV++ Sbjct: 115 GDEVHGQYSLLDSDGHQRIVDYHADHHTGFNAVVRR 150 Score = 41.1 bits (92), Expect = 3e-05 Identities = 17/29 (58%), Positives = 22/29 (75%) Frame = +3 Query: 420 EEYAHPKYDFAYSVADGHSGDNKSQHESR 506 E +A Y+F+YSV D H+GD KSQHE+R Sbjct: 85 EHHAPANYEFSYSVHDEHTGDIKSQHETR 113 Score = 23.4 bits (48), Expect = 6.6 Identities = 12/25 (48%), Positives = 13/25 (52%), Gaps = 1/25 (4%) Frame = +3 Query: 363 PEARVIA-PAHKVLVAGHHEEEYAH 434 P A IA P HKV+ H YAH Sbjct: 152 PSAVKIAHPVHKVIAQPVHVSSYAH 176 >AF043433-3|AAC05658.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 231 Score = 52.4 bits (120), Expect = 1e-08 Identities = 22/36 (61%), Positives = 29/36 (80%) Frame = +2 Query: 509 GDAVHGEYTLLEADGSVRKVEYTADDHHGFNAVVKQ 616 GD VHG+Y+LL++DG R V+Y AD H GFNAVV++ Sbjct: 107 GDEVHGQYSLLDSDGHQRIVDYHADHHTGFNAVVRR 142 Score = 41.1 bits (92), Expect = 3e-05 Identities = 17/29 (58%), Positives = 22/29 (75%) Frame = +3 Query: 420 EEYAHPKYDFAYSVADGHSGDNKSQHESR 506 E +A Y+F+YSV D H+GD KSQHE+R Sbjct: 77 EHHAPANYEFSYSVHDEHTGDIKSQHETR 105 Score = 23.4 bits (48), Expect = 6.6 Identities = 8/21 (38%), Positives = 11/21 (52%) Frame = +3 Query: 372 RVIAPAHKVLVAGHHEEEYAH 434 ++ P HKV+ H YAH Sbjct: 148 KIAQPVHKVIAQPVHVSSYAH 168 >AF043433-2|AAC05657.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 239 Score = 52.4 bits (120), Expect = 1e-08 Identities = 22/36 (61%), Positives = 29/36 (80%) Frame = +2 Query: 509 GDAVHGEYTLLEADGSVRKVEYTADDHHGFNAVVKQ 616 GD VHG+Y+LL++DG R V+Y AD H GFNAVV++ Sbjct: 115 GDEVHGQYSLLDSDGHQRIVDYHADHHTGFNAVVRR 150 Score = 41.1 bits (92), Expect = 3e-05 Identities = 17/29 (58%), Positives = 22/29 (75%) Frame = +3 Query: 420 EEYAHPKYDFAYSVADGHSGDNKSQHESR 506 E +A Y+F+YSV D H+GD KSQHE+R Sbjct: 85 EHHAPANYEFSYSVHDEHTGDIKSQHETR 113 >AF043439-1|AAC05664.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 239 Score = 52.0 bits (119), Expect = 2e-08 Identities = 22/36 (61%), Positives = 29/36 (80%) Frame = +2 Query: 509 GDAVHGEYTLLEADGSVRKVEYTADDHHGFNAVVKQ 616 GD VHG+Y+LL++DG R V+Y AD H GFNAVV++ Sbjct: 115 GDEVHGQYSLLDSDGHHRIVDYHADHHTGFNAVVRR 150 Score = 41.1 bits (92), Expect = 3e-05 Identities = 17/29 (58%), Positives = 22/29 (75%) Frame = +3 Query: 420 EEYAHPKYDFAYSVADGHSGDNKSQHESR 506 E +A Y+F+YSV D H+GD KSQHE+R Sbjct: 85 EHHAPANYEFSYSVHDEHTGDIKSQHETR 113 Score = 23.4 bits (48), Expect = 6.6 Identities = 8/21 (38%), Positives = 11/21 (52%) Frame = +3 Query: 372 RVIAPAHKVLVAGHHEEEYAH 434 ++ P HKV+ H YAH Sbjct: 156 KIAQPVHKVIAQPVHVSSYAH 176 >AF043433-1|AAC05656.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 231 Score = 52.0 bits (119), Expect = 2e-08 Identities = 22/35 (62%), Positives = 28/35 (80%) Frame = +2 Query: 509 GDAVHGEYTLLEADGSVRKVEYTADDHHGFNAVVK 613 GD VHG+Y+LL++DG R V+Y AD H GFNAVV+ Sbjct: 107 GDEVHGQYSLLDSDGHQRIVDYHADHHTGFNAVVR 141 Score = 39.9 bits (89), Expect = 7e-05 Identities = 16/29 (55%), Positives = 22/29 (75%) Frame = +3 Query: 420 EEYAHPKYDFAYSVADGHSGDNKSQHESR 506 E +A Y+F+YSV D H+GD K+QHE+R Sbjct: 77 EHHAPANYEFSYSVHDEHTGDIKNQHETR 105 Score = 23.4 bits (48), Expect = 6.6 Identities = 8/21 (38%), Positives = 11/21 (52%) Frame = +3 Query: 372 RVIAPAHKVLVAGHHEEEYAH 434 ++ P HKV+ H YAH Sbjct: 148 KIAQPVHKVIAQPVHVSSYAH 168 >U50469-1|AAA93473.1| 160|Anopheles gambiae protein ( Anopheles gambiae putativecuticle protein mRNA, partial cds. ). Length = 160 Score = 51.2 bits (117), Expect = 3e-08 Identities = 20/36 (55%), Positives = 29/36 (80%) Frame = +2 Query: 509 GDAVHGEYTLLEADGSVRKVEYTADDHHGFNAVVKQ 616 GD V G Y++++ DG+ R V+YTAD H+GFNAVV++ Sbjct: 46 GDVVQGSYSVVDPDGTKRTVDYTADPHNGFNAVVRR 81 >AF364132-1|AAL35508.1| 397|Anopheles gambiae putative odorant receptor Or4 protein. Length = 397 Score = 25.8 bits (54), Expect = 1.2 Identities = 11/25 (44%), Positives = 12/25 (48%) Frame = +3 Query: 6 YVCQNCCFKHCTSSGHCRSLTRTTL 80 YVC C S GHC TR T+ Sbjct: 202 YVCNLKVMTICCSIGHCTLYTRMTI 226 >EF382662-1|ABN54495.1| 178|Anopheles gambiae CPF family cuticle protein protein. Length = 178 Score = 24.6 bits (51), Expect = 2.9 Identities = 14/36 (38%), Positives = 16/36 (44%), Gaps = 2/36 (5%) Frame = +3 Query: 351 HYAAPEARVIAPAHKVLVAGHH--EEEYAHPKYDFA 452 HYAAP A AH A H+ YA P +A Sbjct: 95 HYAAPAVHYPAAAHYAAPAVHYPAAAHYAAPAVHYA 130 >AB090817-1|BAC57909.1| 344|Anopheles gambiae gag-like protein protein. Length = 344 Score = 24.2 bits (50), Expect = 3.8 Identities = 15/36 (41%), Positives = 19/36 (52%), Gaps = 2/36 (5%) Frame = +3 Query: 15 QNC--CFKHCTSSGHCRSLTRTTLLVGCGRLLSEHR 116 Q C C+K +S HCR R+ L CG LS H+ Sbjct: 275 QKCYKCWKVGHTSYHCREPDRSNLCWKCG--LSGHK 308 >AB097148-2|BAC82628.1| 1077|Anopheles gambiae pol-like protein protein. Length = 1077 Score = 23.8 bits (49), Expect = 5.0 Identities = 9/24 (37%), Positives = 12/24 (50%) Frame = -2 Query: 85 TSNVVRVRDLQWPLLVQCLKQQFW 14 T+NV L W LL+ +Q W Sbjct: 752 TNNVREAMSLNWDLLIHHFRQLVW 775 >AY341195-1|AAR13759.1| 294|Anopheles gambiae laminin protein. Length = 294 Score = 23.0 bits (47), Expect = 8.8 Identities = 10/30 (33%), Positives = 16/30 (53%) Frame = +2 Query: 527 EYTLLEADGSVRKVEYTADDHHGFNAVVKQ 616 E + E DG+++K YT GF V++ Sbjct: 225 EKAVAEGDGTLQKANYTYQTLAGFKNQVEE 254 >AY341194-1|AAR13758.1| 294|Anopheles gambiae laminin protein. Length = 294 Score = 23.0 bits (47), Expect = 8.8 Identities = 10/30 (33%), Positives = 16/30 (53%) Frame = +2 Query: 527 EYTLLEADGSVRKVEYTADDHHGFNAVVKQ 616 E + E DG+++K YT GF V++ Sbjct: 225 EKAVAEGDGTLQKANYTYQTLAGFKNQVEE 254 >AY341193-1|AAR13757.1| 294|Anopheles gambiae laminin protein. Length = 294 Score = 23.0 bits (47), Expect = 8.8 Identities = 10/30 (33%), Positives = 16/30 (53%) Frame = +2 Query: 527 EYTLLEADGSVRKVEYTADDHHGFNAVVKQ 616 E + E DG+++K YT GF V++ Sbjct: 225 EKAVAEGDGTLQKANYTYQTLAGFKNQVEE 254 >AY341192-1|AAR13756.1| 294|Anopheles gambiae laminin protein. Length = 294 Score = 23.0 bits (47), Expect = 8.8 Identities = 10/30 (33%), Positives = 16/30 (53%) Frame = +2 Query: 527 EYTLLEADGSVRKVEYTADDHHGFNAVVKQ 616 E + E DG+++K YT GF V++ Sbjct: 225 EKAVAEGDGTLQKANYTYQTLAGFKNQVEE 254 >AJ271193-1|CAB66001.1| 1623|Anopheles gambiae laminin gamma 1 precursor protein. Length = 1623 Score = 23.0 bits (47), Expect = 8.8 Identities = 10/30 (33%), Positives = 16/30 (53%) Frame = +2 Query: 527 EYTLLEADGSVRKVEYTADDHHGFNAVVKQ 616 E + E DG+++K YT GF V++ Sbjct: 1364 EKAVAEGDGTLQKANYTYQTLAGFKNQVEE 1393 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 492,060 Number of Sequences: 2352 Number of extensions: 7302 Number of successful extensions: 66 Number of sequences better than 10.0: 23 Number of HSP's better than 10.0 without gapping: 40 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 65 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 67322955 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -