BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0863 (671 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g49890.1 68414.m05593 expressed protein contains Pfam domain,... 29 2.8 At5g63870.3 68418.m08019 serine/threonine protein phosphatase (P... 29 3.7 At5g63870.2 68418.m08018 serine/threonine protein phosphatase (P... 29 3.7 At5g63870.1 68418.m08017 serine/threonine protein phosphatase (P... 29 3.7 >At1g49890.1 68414.m05593 expressed protein contains Pfam domain, PF04484: Family of unknown function (DUF566) Length = 659 Score = 29.1 bits (62), Expect = 2.8 Identities = 18/54 (33%), Positives = 29/54 (53%) Frame = +1 Query: 367 KPE*SLQPTKYLSPATMKKNMLTLNTTSLTPWLTDTVATTSLSTSPARRRCARR 528 +P P++YLSP+ T TT+ T T T +++S S+S A R ++R Sbjct: 30 RPRGKQVPSRYLSPSPSHSVSSTTTTTTTT---TTTTSSSSSSSSSAILRTSKR 80 >At5g63870.3 68418.m08019 serine/threonine protein phosphatase (PP7) identical to PP7 [Arabidopsis thaliana] GI:2791900 Length = 301 Score = 28.7 bits (61), Expect = 3.7 Identities = 17/55 (30%), Positives = 25/55 (45%) Frame = +3 Query: 372 RVIAPAHKVLVAGHHEEEYAHPKYDFAYSVADGHSGDNKSQHESREATLCTANTP 536 +V+ P L+ G+HE +Y Y F V + GD K +H R+ C P Sbjct: 132 KVLMPDRVYLLRGNHESKYCTSMYGFEKEVLTKY-GD-KGKHVYRKCLGCFEGLP 184 >At5g63870.2 68418.m08018 serine/threonine protein phosphatase (PP7) identical to PP7 [Arabidopsis thaliana] GI:2791900 Length = 413 Score = 28.7 bits (61), Expect = 3.7 Identities = 17/55 (30%), Positives = 25/55 (45%) Frame = +3 Query: 372 RVIAPAHKVLVAGHHEEEYAHPKYDFAYSVADGHSGDNKSQHESREATLCTANTP 536 +V+ P L+ G+HE +Y Y F V + GD K +H R+ C P Sbjct: 132 KVLMPDRVYLLRGNHESKYCTSMYGFEKEVLTKY-GD-KGKHVYRKCLGCFEGLP 184 >At5g63870.1 68418.m08017 serine/threonine protein phosphatase (PP7) identical to PP7 [Arabidopsis thaliana] GI:2791900 Length = 413 Score = 28.7 bits (61), Expect = 3.7 Identities = 17/55 (30%), Positives = 25/55 (45%) Frame = +3 Query: 372 RVIAPAHKVLVAGHHEEEYAHPKYDFAYSVADGHSGDNKSQHESREATLCTANTP 536 +V+ P L+ G+HE +Y Y F V + GD K +H R+ C P Sbjct: 132 KVLMPDRVYLLRGNHESKYCTSMYGFEKEVLTKY-GD-KGKHVYRKCLGCFEGLP 184 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,165,853 Number of Sequences: 28952 Number of extensions: 156960 Number of successful extensions: 488 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 483 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 488 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1422784080 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -