BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0862 (623 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_A1XDB3 Cluster: STIP; n=1; Bombyx mori|Rep: STIP - Bomb... 40 0.037 UniRef50_Q63V37 Cluster: Putative uncharacterized protein; n=1; ... 35 1.8 UniRef50_O82022 Cluster: ENBP1 protein; n=3; Papilionoideae|Rep:... 34 3.2 UniRef50_UPI00006A0566 Cluster: UPI00006A0566 related cluster; n... 33 5.6 UniRef50_A6W593 Cluster: Transcriptional regulator, TetR family;... 33 7.3 UniRef50_UPI00005A1247 Cluster: PREDICTED: similar to USP6 N-ter... 32 9.7 UniRef50_Q2G3U9 Cluster: Putative uncharacterized protein precur... 32 9.7 >UniRef50_A1XDB3 Cluster: STIP; n=1; Bombyx mori|Rep: STIP - Bombyx mori (Silk moth) Length = 782 Score = 40.3 bits (90), Expect = 0.037 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +1 Query: 337 AGWWYLPVRTHKRSYHQ 387 A WWYLP RTHKRSYH+ Sbjct: 569 AEWWYLPARTHKRSYHR 585 >UniRef50_Q63V37 Cluster: Putative uncharacterized protein; n=1; Burkholderia pseudomallei|Rep: Putative uncharacterized protein - Burkholderia pseudomallei (Pseudomonas pseudomallei) Length = 72 Score = 34.7 bits (76), Expect = 1.8 Identities = 15/43 (34%), Positives = 25/43 (58%) Frame = +3 Query: 204 VTGAHRHLKRKCTTTLRISSKVSVSYNGRPALQTETHYCFTVQ 332 V+GAHR +R C+ + ++V+ NGR L++ H T+Q Sbjct: 26 VSGAHRVARRACSHAMASLTQVNAGVNGRHRLESSLHAFATIQ 68 >UniRef50_O82022 Cluster: ENBP1 protein; n=3; Papilionoideae|Rep: ENBP1 protein - Medicago truncatula (Barrel medic) Length = 1701 Score = 33.9 bits (74), Expect = 3.2 Identities = 16/36 (44%), Positives = 23/36 (63%) Frame = -2 Query: 427 NKNQIRKIIICVITGGRTSCESARVGTTTRPICTVK 320 +KN+I+K + ++T G T C SA VGTT + T K Sbjct: 317 SKNKIKKKEVDLVTNGETVCGSANVGTTVEILETEK 352 >UniRef50_UPI00006A0566 Cluster: UPI00006A0566 related cluster; n=76; Xenopus tropicalis|Rep: UPI00006A0566 UniRef100 entry - Xenopus tropicalis Length = 877 Score = 33.1 bits (72), Expect = 5.6 Identities = 12/24 (50%), Positives = 18/24 (75%) Frame = +2 Query: 143 LCANRTGYFFYCLTVYLVLSGYWS 214 LC +G+FF+C+ Y+VL GYW+ Sbjct: 745 LCNEGSGFFFFCIIGYIVL-GYWA 767 >UniRef50_A6W593 Cluster: Transcriptional regulator, TetR family; n=1; Kineococcus radiotolerans SRS30216|Rep: Transcriptional regulator, TetR family - Kineococcus radiotolerans SRS30216 Length = 222 Score = 32.7 bits (71), Expect = 7.3 Identities = 16/29 (55%), Positives = 17/29 (58%) Frame = +2 Query: 290 PRPSNRNALLLHGTNRPGGGTYPCGLTRG 376 PRP R A GT R GGGT P G +RG Sbjct: 193 PRPPGRAAGPARGTTRSGGGTRPGGGSRG 221 >UniRef50_UPI00005A1247 Cluster: PREDICTED: similar to USP6 N-terminal like protein (Related to the N terminus of tre) (RN-tre); n=1; Canis lupus familiaris|Rep: PREDICTED: similar to USP6 N-terminal like protein (Related to the N terminus of tre) (RN-tre) - Canis familiaris Length = 502 Score = 32.3 bits (70), Expect = 9.7 Identities = 17/42 (40%), Positives = 20/42 (47%) Frame = +2 Query: 254 NKFEGLS*LQRPPRPSNRNALLLHGTNRPGGGTYPCGLTRGP 379 + +G L PPRPS R + L RP G P L RGP Sbjct: 18 SSLQGTCCLPGPPRPSERGHVRLTCDPRPRGCRPPAALARGP 59 >UniRef50_Q2G3U9 Cluster: Putative uncharacterized protein precursor; n=1; Novosphingobium aromaticivorans DSM 12444|Rep: Putative uncharacterized protein precursor - Novosphingobium aromaticivorans (strain DSM 12444) Length = 260 Score = 32.3 bits (70), Expect = 9.7 Identities = 19/46 (41%), Positives = 24/46 (52%) Frame = -1 Query: 341 PAYLYREAVMRFGLKGGAAVVTN*DLRTYSQSGGAFAF*MSMGSSN 204 PA+ EA F + G A VT+ R S SGG FA S+G S+ Sbjct: 35 PAFAQEEAASDFTVTGNVAAVTDYRFRGISLSGGDFAVQGSIGVSH 80 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 632,498,110 Number of Sequences: 1657284 Number of extensions: 12907312 Number of successful extensions: 27224 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 26555 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 27220 length of database: 575,637,011 effective HSP length: 97 effective length of database: 414,880,463 effective search space used: 45636850930 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -