BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0862 (623 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC1751.04 |||sequence orphan|Schizosaccharomyces pombe|chr 1||... 26 5.1 SPAC22G7.10 |||mRNA cleavage and polyadenylation specificity fac... 26 5.1 SPAC806.04c |||DUF89 family protein|Schizosaccharomyces pombe|ch... 25 6.7 >SPAC1751.04 |||sequence orphan|Schizosaccharomyces pombe|chr 1|||Manual Length = 123 Score = 25.8 bits (54), Expect = 5.1 Identities = 12/36 (33%), Positives = 19/36 (52%) Frame = -3 Query: 615 NATSVTFISCSCRRSLKDKTSGAIVSSDRTLFESCS 508 + VT I+ S +S K + ++S LFESC+ Sbjct: 24 SVVDVTMINISLYKSYKSYPTNKVLSELAALFESCN 59 >SPAC22G7.10 |||mRNA cleavage and polyadenylation specificity factor complex subunit, Fip1 homolog |Schizosaccharomyces pombe|chr 1|||Manual Length = 344 Score = 25.8 bits (54), Expect = 5.1 Identities = 9/26 (34%), Positives = 13/26 (50%) Frame = +2 Query: 329 TNRPGGGTYPCGLTRGPTTSNYANYN 406 +N P YP R P+ Y+NY+ Sbjct: 306 SNHPHSSNYPSSSRRKPSPDRYSNYS 331 >SPAC806.04c |||DUF89 family protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 440 Score = 25.4 bits (53), Expect = 6.7 Identities = 12/63 (19%), Positives = 27/63 (42%) Frame = +3 Query: 192 WC*VVTGAHRHLKRKCTTTLRISSKVSVSYNGRPALQTETHYCFTVQIGRVVVPTRADSQ 371 W ++TG + + + + S V G+P L + ++ R +VP + Q Sbjct: 28 WGIILTGIEKDVSERLSKLASTSKDSEVVAQGKPLLNDLEAFKSDIKNDRPLVPLEGEGQ 87 Query: 372 EVL 380 +++ Sbjct: 88 DIV 90 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,613,785 Number of Sequences: 5004 Number of extensions: 54717 Number of successful extensions: 100 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 100 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 100 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 275671126 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -