BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0862 (623 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CR954257-1|CAJ14152.1| 324|Anopheles gambiae putative dodecenoy... 26 0.85 U51225-1|AAA96405.1| 692|Anopheles gambiae hexamerin protein. 24 3.4 AF020872-1|AAC31875.1| 692|Anopheles gambiae hexamerin A protein. 24 3.4 AF020871-1|AAC31874.1| 692|Anopheles gambiae hexamerin A protein. 24 3.4 AJ304406-1|CAC35454.1| 131|Anopheles gambiae putative epidermal... 24 4.5 >CR954257-1|CAJ14152.1| 324|Anopheles gambiae putative dodecenoylCoA deltaisomerase protein. Length = 324 Score = 26.2 bits (55), Expect = 0.85 Identities = 11/30 (36%), Positives = 16/30 (53%) Frame = -2 Query: 472 QMLTFDFHGEEITSCNKNQIRKIIICVITG 383 Q L+ H E + + IRK ++C ITG Sbjct: 119 QALSIVHHPEGVMGPTRRMIRKPLVCAITG 148 >U51225-1|AAA96405.1| 692|Anopheles gambiae hexamerin protein. Length = 692 Score = 24.2 bits (50), Expect = 3.4 Identities = 11/35 (31%), Positives = 15/35 (42%) Frame = +2 Query: 350 TYPCGLTRGPTTSNYANYNFADLIFITRCYFFTVE 454 TYP T Y NYN D+ Y+F ++ Sbjct: 207 TYPMDYYNNFYTEEYLNYNTEDIGLNAYYYYFMMD 241 >AF020872-1|AAC31875.1| 692|Anopheles gambiae hexamerin A protein. Length = 692 Score = 24.2 bits (50), Expect = 3.4 Identities = 11/35 (31%), Positives = 15/35 (42%) Frame = +2 Query: 350 TYPCGLTRGPTTSNYANYNFADLIFITRCYFFTVE 454 TYP T Y NYN D+ Y+F ++ Sbjct: 207 TYPMDYYNNFYTEEYLNYNTEDIGLNAYYYYFMMD 241 >AF020871-1|AAC31874.1| 692|Anopheles gambiae hexamerin A protein. Length = 692 Score = 24.2 bits (50), Expect = 3.4 Identities = 11/35 (31%), Positives = 15/35 (42%) Frame = +2 Query: 350 TYPCGLTRGPTTSNYANYNFADLIFITRCYFFTVE 454 TYP T Y NYN D+ Y+F ++ Sbjct: 207 TYPMDYYNNFYTEEYLNYNTEDIGLNAYYYYFMMD 241 >AJ304406-1|CAC35454.1| 131|Anopheles gambiae putative epidermal growth factor receptorprotein. Length = 131 Score = 23.8 bits (49), Expect = 4.5 Identities = 9/24 (37%), Positives = 16/24 (66%) Frame = -2 Query: 427 NKNQIRKIIICVITGGRTSCESAR 356 +KN+I ++ +C+ T GR S + R Sbjct: 31 HKNEINEMRVCIGTNGRMSVPANR 54 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 683,091 Number of Sequences: 2352 Number of extensions: 14304 Number of successful extensions: 24 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 24 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 24 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 60632475 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -