BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0858 (605 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ855492-1|ABH88179.1| 251|Tribolium castaneum chemosensory pro... 23 2.6 DQ855500-1|ABH88187.1| 126|Tribolium castaneum chemosensory pro... 22 4.6 AF025669-1|AAB81523.1| 243|Tribolium castaneum GABA receptor su... 22 4.6 DQ855499-1|ABH88186.1| 124|Tribolium castaneum chemosensory pro... 21 6.1 AM292365-1|CAL23177.1| 313|Tribolium castaneum gustatory recept... 21 8.1 AM292325-1|CAL23137.2| 309|Tribolium castaneum gustatory recept... 21 8.1 >DQ855492-1|ABH88179.1| 251|Tribolium castaneum chemosensory protein 6 protein. Length = 251 Score = 22.6 bits (46), Expect = 2.6 Identities = 12/26 (46%), Positives = 14/26 (53%) Frame = +2 Query: 488 LAAHPPFPAGVIAKRPAPIALPNSCA 565 L+ P P GV KR P AL +CA Sbjct: 48 LSKGPCPPQGVDLKRVLPEALQTNCA 73 >DQ855500-1|ABH88187.1| 126|Tribolium castaneum chemosensory protein 14 protein. Length = 126 Score = 21.8 bits (44), Expect = 4.6 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +2 Query: 509 PAGVIAKRPAPIALPNSCA 565 P G KR P AL N CA Sbjct: 55 PEGEELKRDIPEALQNECA 73 >AF025669-1|AAB81523.1| 243|Tribolium castaneum GABA receptor subunit protein. Length = 243 Score = 21.8 bits (44), Expect = 4.6 Identities = 8/13 (61%), Positives = 11/13 (84%) Frame = -3 Query: 387 GPPLEVGGGIYVV 349 GPP+EVG +YV+ Sbjct: 62 GPPVEVGVTMYVL 74 >DQ855499-1|ABH88186.1| 124|Tribolium castaneum chemosensory protein 13 protein. Length = 124 Score = 21.4 bits (43), Expect = 6.1 Identities = 9/19 (47%), Positives = 11/19 (57%) Frame = +2 Query: 509 PAGVIAKRPAPIALPNSCA 565 P+G K+ P AL N CA Sbjct: 53 PSGEELKKDIPDALKNECA 71 >AM292365-1|CAL23177.1| 313|Tribolium castaneum gustatory receptor candidate 44 protein. Length = 313 Score = 21.0 bits (42), Expect = 8.1 Identities = 13/33 (39%), Positives = 15/33 (45%) Frame = -3 Query: 147 KVRTYCGTL*SRLCA*ELVYCGRFFLVRELLCI 49 KV T G L +LVYC F + L CI Sbjct: 20 KVLTILGLLSCSFPKKKLVYCIIFGAIATLTCI 52 >AM292325-1|CAL23137.2| 309|Tribolium castaneum gustatory receptor candidate 4 protein. Length = 309 Score = 21.0 bits (42), Expect = 8.1 Identities = 13/33 (39%), Positives = 15/33 (45%) Frame = -3 Query: 147 KVRTYCGTL*SRLCA*ELVYCGRFFLVRELLCI 49 KV T G L +LVYC F + L CI Sbjct: 16 KVLTILGLLSCSFPKKKLVYCIIFGAIATLTCI 48 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 152,152 Number of Sequences: 336 Number of extensions: 3424 Number of successful extensions: 17 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 17 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 17 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 15352827 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -