BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0857 (637 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY119115-1|AAM50975.1| 715|Drosophila melanogaster RE15579p pro... 83 2e-16 AE014298-2|ABC67158.1| 715|Drosophila melanogaster CG17131-PB, ... 83 2e-16 AE014298-1|AAZ52488.1| 715|Drosophila melanogaster CG17131-PA, ... 83 2e-16 >AY119115-1|AAM50975.1| 715|Drosophila melanogaster RE15579p protein. Length = 715 Score = 83.4 bits (197), Expect = 2e-16 Identities = 34/43 (79%), Positives = 38/43 (88%) Frame = +2 Query: 341 RIAFEKLTDVDFSGTAYYTVRNLSLYECQGWCREEPDCQAASF 469 R+AFEKLTD DF G YY+V+NLSLYECQGWCREE DCQAA+F Sbjct: 37 RMAFEKLTDFDFPGNTYYSVKNLSLYECQGWCREEADCQAAAF 79 >AE014298-2|ABC67158.1| 715|Drosophila melanogaster CG17131-PB, isoform B protein. Length = 715 Score = 83.4 bits (197), Expect = 2e-16 Identities = 34/43 (79%), Positives = 38/43 (88%) Frame = +2 Query: 341 RIAFEKLTDVDFSGTAYYTVRNLSLYECQGWCREEPDCQAASF 469 R+AFEKLTD DF G YY+V+NLSLYECQGWCREE DCQAA+F Sbjct: 37 RMAFEKLTDFDFPGNTYYSVKNLSLYECQGWCREEADCQAAAF 79 >AE014298-1|AAZ52488.1| 715|Drosophila melanogaster CG17131-PA, isoform A protein. Length = 715 Score = 83.4 bits (197), Expect = 2e-16 Identities = 34/43 (79%), Positives = 38/43 (88%) Frame = +2 Query: 341 RIAFEKLTDVDFSGTAYYTVRNLSLYECQGWCREEPDCQAASF 469 R+AFEKLTD DF G YY+V+NLSLYECQGWCREE DCQAA+F Sbjct: 37 RMAFEKLTDFDFPGNTYYSVKNLSLYECQGWCREEADCQAAAF 79 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 26,947,139 Number of Sequences: 53049 Number of extensions: 514286 Number of successful extensions: 1078 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1051 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1078 length of database: 24,988,368 effective HSP length: 82 effective length of database: 20,638,350 effective search space used: 2662347150 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -