BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0857 (637 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g56120.1 68416.m06237 Met-10+ like family protein non-consens... 29 2.0 At3g51710.1 68416.m05670 curculin-like (mannose-binding) lectin ... 29 2.6 At5g46270.1 68418.m05696 disease resistance protein (TIR-NBS-LRR... 27 7.9 At4g27720.1 68417.m03984 expressed protein contains Pfam PF05631... 27 7.9 At3g60160.1 68416.m06717 ABC transporter family protein similar ... 27 7.9 >At3g56120.1 68416.m06237 Met-10+ like family protein non-consensus TT donor splice site at exon 4 ; contains Pfam profile PF02475: Met-10+ like-protein Length = 468 Score = 29.5 bits (63), Expect = 2.0 Identities = 17/58 (29%), Positives = 25/58 (43%) Frame = -3 Query: 248 ETQDLISQVTQEPNPEFNHLTSATTARENVQSFTSN*IKSPRT*QRALGTN*RGNELR 75 + DLI + F+HL + +T +N+QS N R TN G E+R Sbjct: 262 KVDDLICVHNMDARKFFSHLMAVSTCEDNLQSVADNDKTKEAAVSRGGETNSSGEEIR 319 >At3g51710.1 68416.m05670 curculin-like (mannose-binding) lectin family protein / PAN domain-containing protein contains Pfam profiles: PF01453 lectin (probable mannose binding), PF00024 PAN domain Length = 476 Score = 29.1 bits (62), Expect = 2.6 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +2 Query: 398 VRNLSLYECQGWCREEPDCQAASFRCGE 481 VRN+S C+ C+++ +C AAS+ E Sbjct: 353 VRNISKERCEELCKKDCECGAASYSVSE 380 >At5g46270.1 68418.m05696 disease resistance protein (TIR-NBS-LRR class), putative domain signature TIR-NBS-LRR exists, suggestive of a disease resistance protein. Length = 1145 Score = 27.5 bits (58), Expect = 7.9 Identities = 16/31 (51%), Positives = 16/31 (51%) Frame = +2 Query: 359 LTDVDFSGTAYYTVRNLSLYECQGWCREEPD 451 L DVDFS A TV NLS Y EE D Sbjct: 886 LWDVDFSDCAALTVVNLSGYPSDTLSEEEDD 916 >At4g27720.1 68417.m03984 expressed protein contains Pfam PF05631: Protein of unknown function (DUF791) Length = 460 Score = 27.5 bits (58), Expect = 7.9 Identities = 14/30 (46%), Positives = 18/30 (60%) Frame = -1 Query: 469 EGSRLTIRFLSAPALALV*GQVPHGVIRST 380 EGS T FL PAL+ ++PHG I +T Sbjct: 260 EGSMYTFVFLWTPALSPNDEEIPHGFIFAT 289 >At3g60160.1 68416.m06717 ABC transporter family protein similar to ATP-binding cassette transporter MRP8 GI:18031899 from [Arabidopsis thaliana] Length = 1490 Score = 27.5 bits (58), Expect = 7.9 Identities = 15/29 (51%), Positives = 19/29 (65%), Gaps = 1/29 (3%) Frame = -2 Query: 288 LSALLFMLTVLLRRDTGFNLTSHSG-TKP 205 L A LF+L V +R TGF+L SG T+P Sbjct: 188 LLASLFLLAVSIRGKTGFHLLESSGNTEP 216 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,912,994 Number of Sequences: 28952 Number of extensions: 245146 Number of successful extensions: 556 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 545 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 556 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1305036432 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -