BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0856 (663 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_51961| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.022 SB_17278| Best HMM Match : RVT_1 (HMM E-Value=0.0082) 36 0.022 SB_11764| Best HMM Match : DSHCT (HMM E-Value=1.9e-27) 36 0.022 SB_10927| Best HMM Match : RVT_1 (HMM E-Value=6.6e-39) 36 0.022 SB_43828| Best HMM Match : XPG_N (HMM E-Value=1.8) 36 0.029 SB_26135| Best HMM Match : RVT_1 (HMM E-Value=0.072) 36 0.029 SB_19117| Best HMM Match : XPG_N (HMM E-Value=1.8) 36 0.029 SB_43541| Best HMM Match : RVT_1 (HMM E-Value=0) 36 0.029 SB_40765| Best HMM Match : DX (HMM E-Value=1.4) 36 0.029 SB_38808| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.029 SB_20120| Best HMM Match : RVT_1 (HMM E-Value=0) 36 0.029 SB_51257| Best HMM Match : Pox_F16 (HMM E-Value=4.1) 36 0.039 SB_33564| Best HMM Match : RVT_1 (HMM E-Value=0.1) 35 0.051 SB_43973| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.051 SB_58989| Best HMM Match : RVT_1 (HMM E-Value=0) 34 0.090 SB_33578| Best HMM Match : Exo_endo_phos (HMM E-Value=0.00076) 34 0.12 SB_49429| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.16 SB_31373| Best HMM Match : Put_DNA-bind_N (HMM E-Value=8.4) 33 0.16 SB_14726| Best HMM Match : Ribosomal_L30 (HMM E-Value=6.6) 33 0.16 SB_48112| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.16 SB_18046| Best HMM Match : RVT_1 (HMM E-Value=0.34) 33 0.16 SB_4935| Best HMM Match : Pox_F16 (HMM E-Value=5.3) 33 0.21 SB_33076| Best HMM Match : Put_DNA-bind_N (HMM E-Value=8.4) 33 0.21 SB_30407| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.21 SB_42891| Best HMM Match : DUF537 (HMM E-Value=1.2e-23) 33 0.27 SB_54752| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_20783| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.36 SB_31120| Best HMM Match : Pox_F16 (HMM E-Value=5) 32 0.48 SB_16492| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.48 SB_30049| Best HMM Match : FBA_2 (HMM E-Value=7) 31 0.63 SB_37654| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.1 SB_25119| Best HMM Match : Ribosomal_S27 (HMM E-Value=9.4) 31 1.1 SB_43849| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.5 SB_6030| Best HMM Match : rve (HMM E-Value=8.7e-30) 30 1.5 SB_26110| Best HMM Match : HipA_C (HMM E-Value=5.5) 30 1.5 SB_25497| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.5 SB_14729| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.5 SB_4310| Best HMM Match : RVT_1 (HMM E-Value=5e-28) 30 1.5 SB_22775| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_24816| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.4 SB_19530| Best HMM Match : EMI (HMM E-Value=3.5) 29 3.4 SB_2897| Best HMM Match : RVT_1 (HMM E-Value=3e-33) 29 3.4 SB_38717| Best HMM Match : Cornifin (HMM E-Value=7.2) 29 4.5 SB_11193| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.5 SB_49340| Best HMM Match : Homeobox (HMM E-Value=2.9e-21) 28 5.9 SB_58576| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.8 SB_58202| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.8 SB_56220| Best HMM Match : RVT_1 (HMM E-Value=3.7e-16) 28 7.8 SB_45417| Best HMM Match : Homeobox (HMM E-Value=5.1e-09) 28 7.8 SB_43848| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.8 SB_40983| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.8 SB_40552| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.8 SB_38731| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.8 SB_35229| Best HMM Match : Asparaginase_2 (HMM E-Value=3.2e-05) 28 7.8 SB_34180| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.8 SB_34116| Best HMM Match : RVT_1 (HMM E-Value=0) 28 7.8 SB_30890| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.8 SB_29924| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.8 SB_28979| Best HMM Match : RVT_1 (HMM E-Value=1.6e-40) 28 7.8 SB_24244| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.8 SB_22251| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.8 SB_11049| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.8 SB_49184| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.8 SB_40344| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.8 SB_36764| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.8 SB_36762| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.8 SB_24298| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.8 SB_17558| Best HMM Match : Homeobox (HMM E-Value=2.9e-21) 28 7.8 SB_14496| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.8 >SB_51961| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 193 Score = 36.3 bits (80), Expect = 0.022 Identities = 18/43 (41%), Positives = 23/43 (53%) Frame = -2 Query: 308 YHRTARHRSRVHPY*ATASSTVRFQRSFLPRTIRLWNELPSTV 180 Y T RH H + S+ + + SF PR IR+WN LPS V Sbjct: 119 YRVTRRHN---HSFLQLQSNILSYNYSFFPRAIRIWNLLPSNV 158 >SB_17278| Best HMM Match : RVT_1 (HMM E-Value=0.0082) Length = 506 Score = 36.3 bits (80), Expect = 0.022 Identities = 18/43 (41%), Positives = 23/43 (53%) Frame = -2 Query: 308 YHRTARHRSRVHPY*ATASSTVRFQRSFLPRTIRLWNELPSTV 180 Y T RH H + S+ + + SF PR IR+WN LPS V Sbjct: 438 YRVTRRHN---HSFLQLQSNILSYNYSFFPRAIRIWNLLPSNV 477 >SB_11764| Best HMM Match : DSHCT (HMM E-Value=1.9e-27) Length = 1492 Score = 36.3 bits (80), Expect = 0.022 Identities = 18/43 (41%), Positives = 23/43 (53%) Frame = -2 Query: 308 YHRTARHRSRVHPY*ATASSTVRFQRSFLPRTIRLWNELPSTV 180 Y T RH H + S+ + + SF PR IR+WN LPS V Sbjct: 1424 YRVTRRHN---HSFLQLQSNILSYNYSFFPRAIRIWNLLPSNV 1463 >SB_10927| Best HMM Match : RVT_1 (HMM E-Value=6.6e-39) Length = 452 Score = 36.3 bits (80), Expect = 0.022 Identities = 18/43 (41%), Positives = 23/43 (53%) Frame = -2 Query: 308 YHRTARHRSRVHPY*ATASSTVRFQRSFLPRTIRLWNELPSTV 180 Y T RH H + S+ + + SF PR IR+WN LPS V Sbjct: 384 YRVTRRHN---HSFLQLQSNILSYNYSFFPRAIRIWNLLPSNV 423 >SB_43828| Best HMM Match : XPG_N (HMM E-Value=1.8) Length = 174 Score = 35.9 bits (79), Expect = 0.029 Identities = 24/65 (36%), Positives = 33/65 (50%), Gaps = 1/65 (1%) Frame = -2 Query: 305 HRTARHR-SRVHPY*ATASSTVRFQRSFLPRTIRLWNELPSTVFPEHYGMSFFKRGLWIV 129 H+ R R S Y ++ ++ SF PRTIR WN LP+ + E + FKR L I Sbjct: 110 HQDLRTRNSHNFKYYQEKATKNKYFYSFFPRTIRHWNTLPNELV-ELGSIEHFKRDLEIY 168 Query: 128 LNGRQ 114 LN + Sbjct: 169 LNNNK 173 >SB_26135| Best HMM Match : RVT_1 (HMM E-Value=0.072) Length = 375 Score = 35.9 bits (79), Expect = 0.029 Identities = 24/65 (36%), Positives = 33/65 (50%), Gaps = 1/65 (1%) Frame = -2 Query: 305 HRTARHR-SRVHPY*ATASSTVRFQRSFLPRTIRLWNELPSTVFPEHYGMSFFKRGLWIV 129 H+ R R S Y ++ ++ SF PRTIR WN LP+ + E + FKR L I Sbjct: 311 HQDLRTRNSHNFKYYQEKATKNKYFYSFFPRTIRHWNTLPNELV-ELGSIEHFKRDLEIY 369 Query: 128 LNGRQ 114 LN + Sbjct: 370 LNNNK 374 >SB_19117| Best HMM Match : XPG_N (HMM E-Value=1.8) Length = 361 Score = 35.9 bits (79), Expect = 0.029 Identities = 24/65 (36%), Positives = 33/65 (50%), Gaps = 1/65 (1%) Frame = -2 Query: 305 HRTARHR-SRVHPY*ATASSTVRFQRSFLPRTIRLWNELPSTVFPEHYGMSFFKRGLWIV 129 H+ R R S Y ++ ++ SF PRTIR WN LP+ + E + FKR L I Sbjct: 297 HQDLRTRNSHNFKYYQEKATKNKYFYSFFPRTIRHWNTLPNELV-ELGSIEHFKRDLEIY 355 Query: 128 LNGRQ 114 LN + Sbjct: 356 LNNNK 360 >SB_43541| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 581 Score = 35.9 bits (79), Expect = 0.029 Identities = 24/65 (36%), Positives = 33/65 (50%), Gaps = 1/65 (1%) Frame = -2 Query: 305 HRTARHR-SRVHPY*ATASSTVRFQRSFLPRTIRLWNELPSTVFPEHYGMSFFKRGLWIV 129 H+ R R S Y ++ ++ SF PRTIR WN LP+ + E + FKR L I Sbjct: 517 HQDLRTRNSHNFKYYQEKATKNKYFYSFFPRTIRHWNTLPNELV-ELGSIEHFKRDLEIY 575 Query: 128 LNGRQ 114 LN + Sbjct: 576 LNNNK 580 >SB_40765| Best HMM Match : DX (HMM E-Value=1.4) Length = 278 Score = 35.9 bits (79), Expect = 0.029 Identities = 24/65 (36%), Positives = 33/65 (50%), Gaps = 1/65 (1%) Frame = -2 Query: 305 HRTARHR-SRVHPY*ATASSTVRFQRSFLPRTIRLWNELPSTVFPEHYGMSFFKRGLWIV 129 H+ R R S Y ++ ++ SF PRTIR WN LP+ + E + FKR L I Sbjct: 214 HQDLRTRNSHNFKYYQEKATKNKYFYSFFPRTIRHWNTLPNELV-ELDSIEHFKRDLEIY 272 Query: 128 LNGRQ 114 LN + Sbjct: 273 LNNNK 277 >SB_38808| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 824 Score = 35.9 bits (79), Expect = 0.029 Identities = 25/77 (32%), Positives = 37/77 (48%) Frame = -2 Query: 344 LHTNLRLTSSRFYHRTARHRSRVHPY*ATASSTVRFQRSFLPRTIRLWNELPSTVFPEHY 165 + TN+ L + H + + AT + ++ SF PRTIR WN LP+ + E Sbjct: 751 IDTNMYLRPHQDLRTRNSHNFKCYQEKATKN---KYFYSFFPRTIRHWNTLPNELV-ELG 806 Query: 164 GMSFFKRGLWIVLNGRQ 114 + FKR L I LN + Sbjct: 807 SIEHFKRDLEIYLNNNK 823 >SB_20120| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 666 Score = 35.9 bits (79), Expect = 0.029 Identities = 24/65 (36%), Positives = 33/65 (50%), Gaps = 1/65 (1%) Frame = -2 Query: 305 HRTARHR-SRVHPY*ATASSTVRFQRSFLPRTIRLWNELPSTVFPEHYGMSFFKRGLWIV 129 H+ R R S Y ++ ++ SF PRTIR WN LP+ + E + FKR L I Sbjct: 602 HQDLRTRNSHNFKYYQEKATKNKYFYSFFPRTIRHWNTLPNELV-ELGSIEHFKRDLEIY 660 Query: 128 LNGRQ 114 LN + Sbjct: 661 LNNNK 665 >SB_51257| Best HMM Match : Pox_F16 (HMM E-Value=4.1) Length = 243 Score = 35.5 bits (78), Expect = 0.039 Identities = 23/63 (36%), Positives = 28/63 (44%) Frame = -2 Query: 314 RFYHRTARHRSRVHPY*ATASSTVRFQRSFLPRTIRLWNELPSTVFPEHYGMSFFKRGLW 135 +F R R+ Y S+ + SF PRTIR WN LPS V E + FK Sbjct: 170 QFQPNLRRSRTNSSKYNQIQSNVLSHSYSFFPRTIRTWNLLPSEVV-ESSSIDSFKSSAL 228 Query: 134 IVL 126 VL Sbjct: 229 PVL 231 >SB_33564| Best HMM Match : RVT_1 (HMM E-Value=0.1) Length = 2075 Score = 35.1 bits (77), Expect = 0.051 Identities = 18/41 (43%), Positives = 24/41 (58%) Frame = -2 Query: 302 RTARHRSRVHPY*ATASSTVRFQRSFLPRTIRLWNELPSTV 180 R++R SR Y ++ + F SF PRTIR WN LP+ V Sbjct: 1625 RSSRRHSRT--YHQLQANILAFNYSFFPRTIRTWNLLPAEV 1663 >SB_43973| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3142 Score = 35.1 bits (77), Expect = 0.051 Identities = 18/41 (43%), Positives = 24/41 (58%) Frame = -2 Query: 302 RTARHRSRVHPY*ATASSTVRFQRSFLPRTIRLWNELPSTV 180 R++R SR Y ++ + F SF PRTIR WN LP+ V Sbjct: 1071 RSSRRHSRT--YHQLQANILAFNYSFFPRTIRTWNLLPAEV 1109 >SB_58989| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 885 Score = 34.3 bits (75), Expect = 0.090 Identities = 24/75 (32%), Positives = 35/75 (46%), Gaps = 3/75 (4%) Frame = -2 Query: 362 LGALFQLHTNLRLTSSRFYHR-TARHRSRVHP--Y*ATASSTVRFQRSFLPRTIRLWNEL 192 L LF++ L ++R R R R HP + ++S+ SF RTI WN L Sbjct: 799 LTTLFKITRGLLSVNTRGLLRPVTRKTRRSHPESFIPLSTSSASEHLSFFSRTIIQWNNL 858 Query: 191 PSTVFPEHYGMSFFK 147 P+ +F E + FK Sbjct: 859 PALLFNEPCSLPIFK 873 >SB_33578| Best HMM Match : Exo_endo_phos (HMM E-Value=0.00076) Length = 888 Score = 33.9 bits (74), Expect = 0.12 Identities = 20/55 (36%), Positives = 28/55 (50%) Frame = -2 Query: 344 LHTNLRLTSSRFYHRTARHRSRVHPY*ATASSTVRFQRSFLPRTIRLWNELPSTV 180 + +NL L++ R + S Y + T F+ SF+PR IRLWN L TV Sbjct: 709 VQSNLPLSTLSKPLRRSERTSHPEHYDIPYARTNIFKYSFVPRAIRLWNSLEVTV 763 >SB_49429| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 918 Score = 33.5 bits (73), Expect = 0.16 Identities = 21/54 (38%), Positives = 25/54 (46%) Frame = -2 Query: 287 RSRVHPY*ATASSTVRFQRSFLPRTIRLWNELPSTVFPEHYGMSFFKRGLWIVL 126 R+ Y S+ + SF PRTIR WN LPS V E + FK VL Sbjct: 854 RTNSSKYNQIQSNVLSHSYSFFPRTIRTWNLLPSEVI-ESSSIDSFKSSALPVL 906 >SB_31373| Best HMM Match : Put_DNA-bind_N (HMM E-Value=8.4) Length = 198 Score = 33.5 bits (73), Expect = 0.16 Identities = 21/54 (38%), Positives = 25/54 (46%) Frame = -2 Query: 287 RSRVHPY*ATASSTVRFQRSFLPRTIRLWNELPSTVFPEHYGMSFFKRGLWIVL 126 R+ Y S+ + SF PRTIR WN LPS V E + FK VL Sbjct: 134 RTNSSKYNQIQSNVLSHSYSFFPRTIRTWNLLPSEVI-ESSSIDSFKSSALPVL 186 >SB_14726| Best HMM Match : Ribosomal_L30 (HMM E-Value=6.6) Length = 231 Score = 33.5 bits (73), Expect = 0.16 Identities = 15/34 (44%), Positives = 19/34 (55%) Frame = -2 Query: 239 FQRSFLPRTIRLWNELPSTVFPEHYGMSFFKRGL 138 ++ SFLPR +RLWN LP +V F GL Sbjct: 198 YKYSFLPRALRLWNNLPQSVIDMRGCPEAFHSGL 231 >SB_48112| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 232 Score = 33.5 bits (73), Expect = 0.16 Identities = 15/34 (44%), Positives = 19/34 (55%) Frame = -2 Query: 239 FQRSFLPRTIRLWNELPSTVFPEHYGMSFFKRGL 138 ++ SFLPR +RLWN LP +V F GL Sbjct: 199 YKYSFLPRALRLWNNLPQSVIDMRGCPEAFHAGL 232 >SB_18046| Best HMM Match : RVT_1 (HMM E-Value=0.34) Length = 837 Score = 33.5 bits (73), Expect = 0.16 Identities = 21/54 (38%), Positives = 25/54 (46%) Frame = -2 Query: 287 RSRVHPY*ATASSTVRFQRSFLPRTIRLWNELPSTVFPEHYGMSFFKRGLWIVL 126 R+ Y S+ + SF PRTIR WN LPS V E + FK VL Sbjct: 773 RTNSSKYNQIQSNVLSHSYSFFPRTIRTWNLLPSEVI-ESSSIDSFKSSALPVL 825 >SB_4935| Best HMM Match : Pox_F16 (HMM E-Value=5.3) Length = 243 Score = 33.1 bits (72), Expect = 0.21 Identities = 21/54 (38%), Positives = 25/54 (46%) Frame = -2 Query: 287 RSRVHPY*ATASSTVRFQRSFLPRTIRLWNELPSTVFPEHYGMSFFKRGLWIVL 126 R+ Y S+ + SF PRTIR WN LPS V E + FK VL Sbjct: 179 RTNSSKYNQIQSNVLSHSYSFFPRTIRTWNLLPSEVV-ESSSIDSFKSSALPVL 231 >SB_33076| Best HMM Match : Put_DNA-bind_N (HMM E-Value=8.4) Length = 152 Score = 33.1 bits (72), Expect = 0.21 Identities = 21/54 (38%), Positives = 25/54 (46%) Frame = -2 Query: 287 RSRVHPY*ATASSTVRFQRSFLPRTIRLWNELPSTVFPEHYGMSFFKRGLWIVL 126 R+ Y S+ + SF PRTIR WN LPS V E + FK VL Sbjct: 88 RTNSSKYNQIQSNVLSHSYSFFPRTIRTWNLLPSEVV-ESSSIDSFKSSALPVL 140 >SB_30407| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 788 Score = 33.1 bits (72), Expect = 0.21 Identities = 19/47 (40%), Positives = 23/47 (48%) Frame = -2 Query: 287 RSRVHPY*ATASSTVRFQRSFLPRTIRLWNELPSTVFPEHYGMSFFK 147 R+ Y S+ + SF PRTIR WN LPS V E + FK Sbjct: 545 RTNSSKYNQIQSNVLSHSYSFFPRTIRTWNLLPSEVI-ESSSIDSFK 590 >SB_42891| Best HMM Match : DUF537 (HMM E-Value=1.2e-23) Length = 2386 Score = 32.7 bits (71), Expect = 0.27 Identities = 16/36 (44%), Positives = 19/36 (52%) Frame = -2 Query: 287 RSRVHPY*ATASSTVRFQRSFLPRTIRLWNELPSTV 180 R+ Y S+ + SF PRTIR WN LPS V Sbjct: 441 RTNSSKYNQIQSNVLSHSYSFFPRTIRTWNLLPSEV 476 >SB_54752| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 792 Score = 32.3 bits (70), Expect = 0.36 Identities = 17/42 (40%), Positives = 25/42 (59%), Gaps = 4/42 (9%) Frame = -2 Query: 299 TARHRSR-VHPY*ATASSTVR---FQRSFLPRTIRLWNELPS 186 T+R+ +R HP ST ++ S+ PRT++LWN LPS Sbjct: 722 TSRYNTRSYHPNNYRLFSTHNQNYYRNSYFPRTVKLWNSLPS 763 >SB_20783| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 295 Score = 32.3 bits (70), Expect = 0.36 Identities = 17/42 (40%), Positives = 25/42 (59%), Gaps = 4/42 (9%) Frame = -2 Query: 299 TARHRSR-VHPY*ATASSTVR---FQRSFLPRTIRLWNELPS 186 T+R+ +R HP ST ++ S+ PRT++LWN LPS Sbjct: 225 TSRYNTRSYHPNNYRLFSTHNQNYYRNSYFPRTVKLWNSLPS 266 >SB_31120| Best HMM Match : Pox_F16 (HMM E-Value=5) Length = 284 Score = 31.9 bits (69), Expect = 0.48 Identities = 20/54 (37%), Positives = 25/54 (46%) Frame = -2 Query: 287 RSRVHPY*ATASSTVRFQRSFLPRTIRLWNELPSTVFPEHYGMSFFKRGLWIVL 126 R+ Y S+ + SF PRTIR WN LP+ V E + FK VL Sbjct: 220 RTNSSKYNQIQSNVLSHSYSFFPRTIRTWNLLPAQVV-ESSSIDSFKSSALPVL 272 >SB_16492| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 295 Score = 31.9 bits (69), Expect = 0.48 Identities = 10/18 (55%), Positives = 15/18 (83%) Frame = -2 Query: 239 FQRSFLPRTIRLWNELPS 186 ++ S+ PRT++LWN LPS Sbjct: 249 YRNSYFPRTVKLWNSLPS 266 >SB_30049| Best HMM Match : FBA_2 (HMM E-Value=7) Length = 282 Score = 31.5 bits (68), Expect = 0.63 Identities = 14/36 (38%), Positives = 20/36 (55%) Frame = -2 Query: 287 RSRVHPY*ATASSTVRFQRSFLPRTIRLWNELPSTV 180 R + H + S+ + + SF R IR+WN LPS V Sbjct: 218 RRQNHSFLQLQSNILSYNYSFFARAIRIWNLLPSNV 253 >SB_37654| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 865 Score = 30.7 bits (66), Expect = 1.1 Identities = 13/22 (59%), Positives = 14/22 (63%) Frame = -2 Query: 239 FQRSFLPRTIRLWNELPSTVFP 174 F SF RTI +WN LP VFP Sbjct: 826 FLFSFYSRTIPVWNALPQAVFP 847 >SB_25119| Best HMM Match : Ribosomal_S27 (HMM E-Value=9.4) Length = 443 Score = 30.7 bits (66), Expect = 1.1 Identities = 12/25 (48%), Positives = 15/25 (60%) Frame = -2 Query: 254 SSTVRFQRSFLPRTIRLWNELPSTV 180 S+ + F SF PR IR WN LP + Sbjct: 274 SNILSFNYSFFPRAIRAWNLLPDNI 298 >SB_43849| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 771 Score = 30.3 bits (65), Expect = 1.5 Identities = 14/30 (46%), Positives = 19/30 (63%) Frame = -3 Query: 115 SGLALPLALLTSMSDGNHSPSGGCMLICLY 26 SG+ LP+ L+S +H PS GC+LI Y Sbjct: 226 SGIPLPIIGLSSHHRVSHFPSSGCLLIIGY 255 Score = 27.9 bits (59), Expect = 7.8 Identities = 13/32 (40%), Positives = 19/32 (59%) Frame = -3 Query: 121 VGSGLALPLALLTSMSDGNHSPSGGCMLICLY 26 + SG+ LP+ L+S +H PS GC+ I Y Sbjct: 86 LSSGIPLPIIGLSSHHRVSHFPSSGCLPIIGY 117 >SB_6030| Best HMM Match : rve (HMM E-Value=8.7e-30) Length = 1280 Score = 30.3 bits (65), Expect = 1.5 Identities = 12/25 (48%), Positives = 17/25 (68%) Frame = -2 Query: 254 SSTVRFQRSFLPRTIRLWNELPSTV 180 ++T+ F SF R IR+WN LP+ V Sbjct: 1227 ANTLTFNYSFFARAIRIWNLLPNDV 1251 >SB_26110| Best HMM Match : HipA_C (HMM E-Value=5.5) Length = 210 Score = 30.3 bits (65), Expect = 1.5 Identities = 12/25 (48%), Positives = 17/25 (68%) Frame = -2 Query: 254 SSTVRFQRSFLPRTIRLWNELPSTV 180 ++T+ F SF R IR+WN LP+ V Sbjct: 157 ANTLAFNYSFFARAIRIWNLLPNDV 181 >SB_25497| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 372 Score = 30.3 bits (65), Expect = 1.5 Identities = 12/25 (48%), Positives = 17/25 (68%) Frame = -2 Query: 254 SSTVRFQRSFLPRTIRLWNELPSTV 180 ++T+ F SF R IR+WN LP+ V Sbjct: 311 ANTLAFNYSFFARAIRIWNLLPNDV 335 >SB_14729| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 315 Score = 30.3 bits (65), Expect = 1.5 Identities = 12/25 (48%), Positives = 17/25 (68%) Frame = -2 Query: 254 SSTVRFQRSFLPRTIRLWNELPSTV 180 ++T+ F SF R IR+WN LP+ V Sbjct: 262 ANTLAFNYSFFARAIRIWNLLPNDV 286 >SB_4310| Best HMM Match : RVT_1 (HMM E-Value=5e-28) Length = 570 Score = 30.3 bits (65), Expect = 1.5 Identities = 12/25 (48%), Positives = 17/25 (68%) Frame = -2 Query: 254 SSTVRFQRSFLPRTIRLWNELPSTV 180 ++T+ F SF R IR+WN LP+ V Sbjct: 517 ANTLAFNYSFFARAIRIWNLLPNDV 541 >SB_22775| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 29.5 bits (63), Expect = 2.6 Identities = 23/63 (36%), Positives = 32/63 (50%), Gaps = 4/63 (6%) Frame = -2 Query: 374 LCLPLGALFQLHTNLRL----TSSRFYHRTARHRSRVHPY*ATASSTVRFQRSFLPRTIR 207 L L L F++ NL TS + RT+R R+ + Y ++ F SF+PRTIR Sbjct: 64 LMLQLSMFFKIKNNLVKIPFPTSIQENTRTSR-RTDIS-YRQLQANVNAFDMSFIPRTIR 121 Query: 206 LWN 198 WN Sbjct: 122 TWN 124 >SB_24816| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 662 Score = 29.1 bits (62), Expect = 3.4 Identities = 12/21 (57%), Positives = 15/21 (71%), Gaps = 1/21 (4%) Frame = -2 Query: 239 FQRSFLPRTIRLWNELP-STV 180 F+ SF P IR+WN LP ST+ Sbjct: 630 FKESFFPHAIRMWNGLPVSTI 650 >SB_19530| Best HMM Match : EMI (HMM E-Value=3.5) Length = 244 Score = 29.1 bits (62), Expect = 3.4 Identities = 12/21 (57%), Positives = 15/21 (71%), Gaps = 1/21 (4%) Frame = -2 Query: 239 FQRSFLPRTIRLWNELP-STV 180 F+ SF P IR+WN LP ST+ Sbjct: 212 FKESFFPHAIRMWNGLPVSTI 232 >SB_2897| Best HMM Match : RVT_1 (HMM E-Value=3e-33) Length = 609 Score = 29.1 bits (62), Expect = 3.4 Identities = 16/41 (39%), Positives = 22/41 (53%), Gaps = 1/41 (2%) Frame = -2 Query: 305 HRTARHR-SRVHPY*ATASSTVRFQRSFLPRTIRLWNELPS 186 H+ R R S Y ++ ++ SF PRTIR WN LP+ Sbjct: 543 HQDLRTRNSHNFKYYQEKATKNKYFYSFFPRTIRHWNTLPN 583 >SB_38717| Best HMM Match : Cornifin (HMM E-Value=7.2) Length = 318 Score = 28.7 bits (61), Expect = 4.5 Identities = 13/23 (56%), Positives = 14/23 (60%) Frame = -3 Query: 115 SGLALPLALLTSMSDGNHSPSGG 47 SG+ PLA TS SD H P GG Sbjct: 33 SGIFSPLASSTSASDSRHRPVGG 55 >SB_11193| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 497 Score = 28.7 bits (61), Expect = 4.5 Identities = 13/32 (40%), Positives = 20/32 (62%), Gaps = 1/32 (3%) Frame = +3 Query: 12 FFLLSYRQ-MSIHPPDGEWLPSLMDVSNARGR 104 FFL+ Y + + I P G WL S + +++A GR Sbjct: 284 FFLVRYSEDLGIPPSTGSWLISYLGIASAVGR 315 >SB_49340| Best HMM Match : Homeobox (HMM E-Value=2.9e-21) Length = 193 Score = 28.3 bits (60), Expect = 5.9 Identities = 17/52 (32%), Positives = 23/52 (44%) Frame = -3 Query: 298 PPVTGVEYIHTKPLRHPQCVSRDLFCHVPSGFGMSSLPRCFPSTMACPSSNE 143 PP + Y +TKPL H C + +PS S L PS C S++ Sbjct: 119 PPAPLLTYSNTKPLSHVDCTAPAPV--LPSYLTSSRLATGIPSPWMCAPSSQ 168 >SB_58576| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 27.9 bits (59), Expect = 7.8 Identities = 22/63 (34%), Positives = 32/63 (50%), Gaps = 4/63 (6%) Frame = -2 Query: 374 LCLPLGALFQLHTNLRL----TSSRFYHRTARHRSRVHPY*ATASSTVRFQRSFLPRTIR 207 L L L F++ N+ TS + RT+R R+ + Y ++ F SF+PRTIR Sbjct: 64 LMLQLSMFFKIKNNIVKIPFPTSIQENTRTSR-RTDIS-YRQLQANVNAFGMSFIPRTIR 121 Query: 206 LWN 198 WN Sbjct: 122 TWN 124 >SB_58202| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 27.9 bits (59), Expect = 7.8 Identities = 18/53 (33%), Positives = 24/53 (45%), Gaps = 1/53 (1%) Frame = -3 Query: 298 PPVTGVEYIHTKPLRHPQCVS-RDLFCHVPSGFGMSSLPRCFPSTMACPSSNE 143 PP + Y +TKPL H C + +F PS S L PS C S++ Sbjct: 45 PPAPLLTYSNTKPLSHVDCTAPAPVF---PSYLTSSRLATGIPSPWMCAPSSQ 94 >SB_56220| Best HMM Match : RVT_1 (HMM E-Value=3.7e-16) Length = 453 Score = 27.9 bits (59), Expect = 7.8 Identities = 22/63 (34%), Positives = 32/63 (50%), Gaps = 4/63 (6%) Frame = -2 Query: 374 LCLPLGALFQLHTNLRL----TSSRFYHRTARHRSRVHPY*ATASSTVRFQRSFLPRTIR 207 L L L F++ N+ TS + RT+R R+ + Y ++ F SF+PRTIR Sbjct: 358 LMLQLSMFFKIKNNIVKIPFPTSIQENTRTSR-RTDIS-YRQLQANVNAFGMSFIPRTIR 415 Query: 206 LWN 198 WN Sbjct: 416 TWN 418 >SB_45417| Best HMM Match : Homeobox (HMM E-Value=5.1e-09) Length = 216 Score = 27.9 bits (59), Expect = 7.8 Identities = 18/53 (33%), Positives = 24/53 (45%), Gaps = 1/53 (1%) Frame = -3 Query: 298 PPVTGVEYIHTKPLRHPQCVS-RDLFCHVPSGFGMSSLPRCFPSTMACPSSNE 143 PP + Y +TKPL H C + +F PS S L PS C S++ Sbjct: 142 PPAPLLTYSNTKPLSHVDCTAPAPVF---PSYLTSSRLATGIPSPWMCAPSSQ 191 >SB_43848| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 547 Score = 27.9 bits (59), Expect = 7.8 Identities = 12/29 (41%), Positives = 18/29 (62%) Frame = -3 Query: 121 VGSGLALPLALLTSMSDGNHSPSGGCMLI 35 + SG+ LP+ L+S +H PS GC+ I Sbjct: 95 LSSGIPLPIIGLSSYDRVSHFPSSGCLPI 123 Score = 27.9 bits (59), Expect = 7.8 Identities = 13/32 (40%), Positives = 19/32 (59%) Frame = -3 Query: 121 VGSGLALPLALLTSMSDGNHSPSGGCMLICLY 26 + SG+ LP+ L+S +H PS GC+ I Y Sbjct: 331 LSSGIPLPIIGLSSHHRVSHFPSSGCLPIIGY 362 >SB_40983| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 27.9 bits (59), Expect = 7.8 Identities = 22/63 (34%), Positives = 32/63 (50%), Gaps = 4/63 (6%) Frame = -2 Query: 374 LCLPLGALFQLHTNLRL----TSSRFYHRTARHRSRVHPY*ATASSTVRFQRSFLPRTIR 207 L L L F++ N+ TS + RT+R R+ + Y ++ F SF+PRTIR Sbjct: 64 LMLQLSMFFKIKNNIVKIPFPTSIQENTRTSR-RTDIS-YRQLQANVNAFGMSFIPRTIR 121 Query: 206 LWN 198 WN Sbjct: 122 TWN 124 >SB_40552| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 27.9 bits (59), Expect = 7.8 Identities = 22/63 (34%), Positives = 32/63 (50%), Gaps = 4/63 (6%) Frame = -2 Query: 374 LCLPLGALFQLHTNLRL----TSSRFYHRTARHRSRVHPY*ATASSTVRFQRSFLPRTIR 207 L L L F++ N+ TS + RT+R R+ + Y ++ F SF+PRTIR Sbjct: 64 LMLQLSMFFKIKNNIVKIPFPTSIQENTRTSR-RTDIS-YRQLQANVNAFGMSFIPRTIR 121 Query: 206 LWN 198 WN Sbjct: 122 TWN 124 >SB_38731| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 27.9 bits (59), Expect = 7.8 Identities = 22/63 (34%), Positives = 32/63 (50%), Gaps = 4/63 (6%) Frame = -2 Query: 374 LCLPLGALFQLHTNLRL----TSSRFYHRTARHRSRVHPY*ATASSTVRFQRSFLPRTIR 207 L L L F++ N+ TS + RT+R R+ + Y ++ F SF+PRTIR Sbjct: 64 LMLQLSMFFKIKNNIVKIPFPTSIQENTRTSR-RTDIS-YRQLQANVNAFGMSFIPRTIR 121 Query: 206 LWN 198 WN Sbjct: 122 TWN 124 >SB_35229| Best HMM Match : Asparaginase_2 (HMM E-Value=3.2e-05) Length = 477 Score = 27.9 bits (59), Expect = 7.8 Identities = 12/26 (46%), Positives = 15/26 (57%), Gaps = 1/26 (3%) Frame = -3 Query: 82 SMSDGNHSPSGGCMLIC-LYDNKKKK 8 S GN P G CML+C LY+ + K Sbjct: 159 SKKSGNPEPEGNCMLVCGLYNPPEHK 184 >SB_34180| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 27.9 bits (59), Expect = 7.8 Identities = 22/63 (34%), Positives = 32/63 (50%), Gaps = 4/63 (6%) Frame = -2 Query: 374 LCLPLGALFQLHTNLRL----TSSRFYHRTARHRSRVHPY*ATASSTVRFQRSFLPRTIR 207 L L L F++ N+ TS + RT+R R+ + Y ++ F SF+PRTIR Sbjct: 64 LMLQLSMFFKIKNNIVKIPFPTSIQENTRTSR-RTDIS-YRQLQANVNAFGMSFIPRTIR 121 Query: 206 LWN 198 WN Sbjct: 122 TWN 124 >SB_34116| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 522 Score = 27.9 bits (59), Expect = 7.8 Identities = 22/63 (34%), Positives = 32/63 (50%), Gaps = 4/63 (6%) Frame = -2 Query: 374 LCLPLGALFQLHTNLRL----TSSRFYHRTARHRSRVHPY*ATASSTVRFQRSFLPRTIR 207 L L L F++ N+ TS + RT+R R+ + Y ++ F SF+PRTIR Sbjct: 427 LMLQLSMFFKIKNNIVKIPFPTSIQENTRTSR-RTDIS-YRQLQANVNAFGMSFIPRTIR 484 Query: 206 LWN 198 WN Sbjct: 485 TWN 487 >SB_30890| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 27.9 bits (59), Expect = 7.8 Identities = 22/63 (34%), Positives = 32/63 (50%), Gaps = 4/63 (6%) Frame = -2 Query: 374 LCLPLGALFQLHTNLRL----TSSRFYHRTARHRSRVHPY*ATASSTVRFQRSFLPRTIR 207 L L L F++ N+ TS + RT+R R+ + Y ++ F SF+PRTIR Sbjct: 64 LMLQLSMFFKIKNNIVKIPFPTSIQENTRTSR-RTDIS-YRQLQANVNAFGMSFIPRTIR 121 Query: 206 LWN 198 WN Sbjct: 122 TWN 124 >SB_29924| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 27.9 bits (59), Expect = 7.8 Identities = 22/63 (34%), Positives = 32/63 (50%), Gaps = 4/63 (6%) Frame = -2 Query: 374 LCLPLGALFQLHTNLRL----TSSRFYHRTARHRSRVHPY*ATASSTVRFQRSFLPRTIR 207 L L L F++ N+ TS + RT+R R+ + Y ++ F SF+PRTIR Sbjct: 64 LMLQLSMFFKIKNNIVKIPFPTSIQENTRTSR-RTDIS-YRQLQANVNAFGMSFIPRTIR 121 Query: 206 LWN 198 WN Sbjct: 122 TWN 124 >SB_28979| Best HMM Match : RVT_1 (HMM E-Value=1.6e-40) Length = 892 Score = 27.9 bits (59), Expect = 7.8 Identities = 22/63 (34%), Positives = 32/63 (50%), Gaps = 4/63 (6%) Frame = -2 Query: 374 LCLPLGALFQLHTNLRL----TSSRFYHRTARHRSRVHPY*ATASSTVRFQRSFLPRTIR 207 L L L F++ N+ TS + RT+R R+ + Y ++ F SF+PRTIR Sbjct: 797 LMLQLSMFFKIKNNIVKIPFPTSIQENTRTSR-RTDIS-YRQLQANVNAFGMSFIPRTIR 854 Query: 206 LWN 198 WN Sbjct: 855 TWN 857 >SB_24244| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 27.9 bits (59), Expect = 7.8 Identities = 22/63 (34%), Positives = 32/63 (50%), Gaps = 4/63 (6%) Frame = -2 Query: 374 LCLPLGALFQLHTNLRL----TSSRFYHRTARHRSRVHPY*ATASSTVRFQRSFLPRTIR 207 L L L F++ N+ TS + RT+R R+ + Y ++ F SF+PRTIR Sbjct: 64 LMLQLSMFFKIKNNIVKIPFPTSIQENTRTSR-RTDIS-YRQLQANVNAFGMSFIPRTIR 121 Query: 206 LWN 198 WN Sbjct: 122 TWN 124 >SB_22251| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 497 Score = 27.9 bits (59), Expect = 7.8 Identities = 22/63 (34%), Positives = 32/63 (50%), Gaps = 4/63 (6%) Frame = -2 Query: 374 LCLPLGALFQLHTNLRL----TSSRFYHRTARHRSRVHPY*ATASSTVRFQRSFLPRTIR 207 L L L F++ N+ TS + RT+R R+ + Y ++ F SF+PRTIR Sbjct: 402 LMLQLSMFFKIKNNIVKIPFPTSIQENTRTSR-RTDIS-YRQLQANVNAFGMSFIPRTIR 459 Query: 206 LWN 198 WN Sbjct: 460 TWN 462 >SB_11049| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 27.9 bits (59), Expect = 7.8 Identities = 18/53 (33%), Positives = 24/53 (45%), Gaps = 1/53 (1%) Frame = -3 Query: 298 PPVTGVEYIHTKPLRHPQCVS-RDLFCHVPSGFGMSSLPRCFPSTMACPSSNE 143 PP + Y +TKPL H C + +F PS S L PS C S++ Sbjct: 45 PPAPLLTYSNTKPLSHVDCTAPAPVF---PSYLTSSRLATGIPSPWMCAPSSQ 94 >SB_49184| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 27.9 bits (59), Expect = 7.8 Identities = 18/53 (33%), Positives = 24/53 (45%), Gaps = 1/53 (1%) Frame = -3 Query: 298 PPVTGVEYIHTKPLRHPQCVS-RDLFCHVPSGFGMSSLPRCFPSTMACPSSNE 143 PP + Y +TKPL H C + +F PS S L PS C S++ Sbjct: 45 PPAPLLTYSNTKPLSHVDCTAPAPVF---PSYLTSSRLATGIPSPWMCAPSSQ 94 >SB_40344| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 401 Score = 27.9 bits (59), Expect = 7.8 Identities = 17/40 (42%), Positives = 22/40 (55%), Gaps = 2/40 (5%) Frame = -2 Query: 302 RTARHRSRVHP--Y*ATASSTVRFQRSFLPRTIRLWNELP 189 RT + RS HP + T F+ SF RTI+ WN+LP Sbjct: 346 RTRQLRSS-HPDKFIELCPRTEAFKNSFFCRTIKEWNKLP 384 >SB_36764| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 27.9 bits (59), Expect = 7.8 Identities = 22/63 (34%), Positives = 32/63 (50%), Gaps = 4/63 (6%) Frame = -2 Query: 374 LCLPLGALFQLHTNLRL----TSSRFYHRTARHRSRVHPY*ATASSTVRFQRSFLPRTIR 207 L L L F++ N+ TS + RT+R R+ + Y ++ F SF+PRTIR Sbjct: 64 LMLQLSMFFKIKNNIVKIPFPTSIQENTRTSR-RTDIS-YRQLQANVNAFGMSFIPRTIR 121 Query: 206 LWN 198 WN Sbjct: 122 TWN 124 >SB_36762| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 27.9 bits (59), Expect = 7.8 Identities = 22/63 (34%), Positives = 32/63 (50%), Gaps = 4/63 (6%) Frame = -2 Query: 374 LCLPLGALFQLHTNLRL----TSSRFYHRTARHRSRVHPY*ATASSTVRFQRSFLPRTIR 207 L L L F++ N+ TS + RT+R R+ + Y ++ F SF+PRTIR Sbjct: 64 LMLQLSMFFKIKNNIVKIPFPTSIQENTRTSR-RTDIS-YRQLQANVNAFGMSFIPRTIR 121 Query: 206 LWN 198 WN Sbjct: 122 TWN 124 >SB_24298| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 27.9 bits (59), Expect = 7.8 Identities = 22/63 (34%), Positives = 32/63 (50%), Gaps = 4/63 (6%) Frame = -2 Query: 374 LCLPLGALFQLHTNLRL----TSSRFYHRTARHRSRVHPY*ATASSTVRFQRSFLPRTIR 207 L L L F++ N+ TS + RT+R R+ + Y ++ F SF+PRTIR Sbjct: 64 LMLQLSMFFKIKNNIVKIQFPTSIQENTRTSR-RTDIS-YKQLQANVNAFGMSFIPRTIR 121 Query: 206 LWN 198 WN Sbjct: 122 TWN 124 >SB_17558| Best HMM Match : Homeobox (HMM E-Value=2.9e-21) Length = 193 Score = 27.9 bits (59), Expect = 7.8 Identities = 18/53 (33%), Positives = 24/53 (45%), Gaps = 1/53 (1%) Frame = -3 Query: 298 PPVTGVEYIHTKPLRHPQCVS-RDLFCHVPSGFGMSSLPRCFPSTMACPSSNE 143 PP + Y +TKPL H C + +F PS S L PS C S++ Sbjct: 119 PPAPLLTYSNTKPLSHVDCTAPAPVF---PSYLTSSRLATGIPSPWMCAPSSQ 168 >SB_14496| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 27.9 bits (59), Expect = 7.8 Identities = 22/63 (34%), Positives = 32/63 (50%), Gaps = 4/63 (6%) Frame = -2 Query: 374 LCLPLGALFQLHTNLRL----TSSRFYHRTARHRSRVHPY*ATASSTVRFQRSFLPRTIR 207 L L L F++ N+ TS + RT+R R+ + Y ++ F SF+PRTIR Sbjct: 15 LMLQLSMFFKIKNNIVKIPFPTSIQENTRTSR-RTDIS-YRQLQANVNAFGMSFIPRTIR 72 Query: 206 LWN 198 WN Sbjct: 73 TWN 75 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,440,287 Number of Sequences: 59808 Number of extensions: 463104 Number of successful extensions: 1287 Number of sequences better than 10.0: 69 Number of HSP's better than 10.0 without gapping: 1196 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1286 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1705624125 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -