BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0846 (698 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC1223.01 ||SPCC285.18|ubiquitin-protein ligase E3 |Schizosacc... 27 3.4 SPAC15A10.11 |ubr11||N-end-recognizing protein |Schizosaccharomy... 26 6.0 SPBC2A9.08c |sec22||SNARE Sec22|Schizosaccharomyces pombe|chr 2|... 25 7.9 >SPCC1223.01 ||SPCC285.18|ubiquitin-protein ligase E3 |Schizosaccharomyces pombe|chr 3|||Manual Length = 732 Score = 26.6 bits (56), Expect = 3.4 Identities = 12/25 (48%), Positives = 15/25 (60%) Frame = +2 Query: 260 PPFASWRNSEEARTDRPSQQLRSLN 334 PP AS RN E + PS+Q S+N Sbjct: 353 PPGASGRNRRERTSSTPSEQSTSVN 377 >SPAC15A10.11 |ubr11||N-end-recognizing protein |Schizosaccharomyces pombe|chr 1|||Manual Length = 2052 Score = 25.8 bits (54), Expect = 6.0 Identities = 12/24 (50%), Positives = 14/24 (58%) Frame = +3 Query: 390 VKSAHFLTNRPKSAKSLINQKNRP 461 VK FLTN + SL+ Q NRP Sbjct: 675 VKDYDFLTNLNATTLSLLTQSNRP 698 >SPBC2A9.08c |sec22||SNARE Sec22|Schizosaccharomyces pombe|chr 2|||Manual Length = 209 Score = 25.4 bits (53), Expect = 7.9 Identities = 11/35 (31%), Positives = 22/35 (62%) Frame = +1 Query: 466 RVECCSSLEQESTIKNVDSNVKGRKTVYQGDGPTT 570 R+ +S++ EST +N++S+ K K + + PT+ Sbjct: 6 RLPLAASVDDESTERNLESHKKQAKLILKRLSPTS 40 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,091,666 Number of Sequences: 5004 Number of extensions: 67258 Number of successful extensions: 134 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 130 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 134 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 323158234 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -