BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0844 (609 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC776.14 |plh1||phospholipid-diacylglycerol acyltransferase Pl... 27 2.8 SPAPB24D3.09c |pdr1||ABC transporter Pdr1|Schizosaccharomyces po... 26 3.7 >SPBC776.14 |plh1||phospholipid-diacylglycerol acyltransferase Plh1|Schizosaccharomyces pombe|chr 2|||Manual Length = 623 Score = 26.6 bits (56), Expect = 2.8 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = +3 Query: 249 GDVTPDDMNESGYQEGS 299 GDV PDD+N++ + G+ Sbjct: 387 GDVAPDDLNQTNFSNGA 403 >SPAPB24D3.09c |pdr1||ABC transporter Pdr1|Schizosaccharomyces pombe|chr 1|||Manual Length = 1396 Score = 26.2 bits (55), Expect = 3.7 Identities = 13/51 (25%), Positives = 27/51 (52%), Gaps = 2/51 (3%) Frame = -1 Query: 258 SHLRDFGGIIIVNFIVHRWFVSHRLGHFVSRLA--RNQIIFHLFVSTTCWF 112 +++RDF I +++ + +SH+LG + + + IFH+F T + Sbjct: 244 NNMRDFDSISVIDILSRIKVLSHKLGTTLVAIVSQASDRIFHMFDMVTLMY 294 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,946,322 Number of Sequences: 5004 Number of extensions: 32400 Number of successful extensions: 92 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 91 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 92 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 268287866 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -