BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0844 (609 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value M93690-2|AAA29363.1| 1212|Anopheles gambiae unknown protein. 27 0.47 AY939827-1|AAY18208.1| 680|Anopheles gambiae CTCF-like protein ... 25 1.9 AY028782-1|AAK32956.1| 501|Anopheles gambiae cytochrome P450 pr... 25 1.9 AY545988-1|AAS99341.1| 423|Anopheles gambiae carboxypeptidase B... 25 2.5 AY062432-1|AAL47188.1| 391|Anopheles gambiae putative odorant r... 25 2.5 AM085517-1|CAJ30215.1| 339|Anopheles gambiae putative angiotens... 25 2.5 AJ627286-1|CAF28572.1| 423|Anopheles gambiae carboxypeptidase B... 25 2.5 AY578803-1|AAT07308.1| 474|Anopheles gambiae mothers against Dp... 23 5.8 AY825832-1|AAV70395.1| 168|Anopheles gambiae heat shock protein... 23 7.7 AY825831-1|AAV70394.1| 168|Anopheles gambiae heat shock protein... 23 7.7 AY825830-1|AAV70393.1| 169|Anopheles gambiae heat shock protein... 23 7.7 AY825829-1|AAV70392.1| 169|Anopheles gambiae heat shock protein... 23 7.7 AY825828-1|AAV70391.1| 172|Anopheles gambiae heat shock protein... 23 7.7 AY825827-1|AAV70390.1| 172|Anopheles gambiae heat shock protein... 23 7.7 AY825826-1|AAV70389.1| 169|Anopheles gambiae heat shock protein... 23 7.7 AY825825-1|AAV70388.1| 169|Anopheles gambiae heat shock protein... 23 7.7 AY825824-1|AAV70387.1| 161|Anopheles gambiae heat shock protein... 23 7.7 AY825823-1|AAV70386.1| 161|Anopheles gambiae heat shock protein... 23 7.7 AY825822-1|AAV70385.1| 159|Anopheles gambiae heat shock protein... 23 7.7 AY825821-1|AAV70384.1| 159|Anopheles gambiae heat shock protein... 23 7.7 AY825820-1|AAV70383.1| 168|Anopheles gambiae heat shock protein... 23 7.7 AY825819-1|AAV70382.1| 168|Anopheles gambiae heat shock protein... 23 7.7 AY825818-1|AAV70381.1| 168|Anopheles gambiae heat shock protein... 23 7.7 AY825817-1|AAV70380.1| 168|Anopheles gambiae heat shock protein... 23 7.7 AY825816-1|AAV70379.1| 162|Anopheles gambiae heat shock protein... 23 7.7 AY825815-1|AAV70378.1| 162|Anopheles gambiae heat shock protein... 23 7.7 AY825814-1|AAV70377.1| 169|Anopheles gambiae heat shock protein... 23 7.7 AY825813-1|AAV70376.1| 169|Anopheles gambiae heat shock protein... 23 7.7 AY825812-1|AAV70375.1| 168|Anopheles gambiae heat shock protein... 23 7.7 AY825811-1|AAV70374.1| 168|Anopheles gambiae heat shock protein... 23 7.7 AY825810-1|AAV70373.1| 169|Anopheles gambiae heat shock protein... 23 7.7 AY825809-1|AAV70372.1| 169|Anopheles gambiae heat shock protein... 23 7.7 AY825808-1|AAV70371.1| 171|Anopheles gambiae heat shock protein... 23 7.7 AY825807-1|AAV70370.1| 171|Anopheles gambiae heat shock protein... 23 7.7 AY825806-1|AAV70369.1| 168|Anopheles gambiae heat shock protein... 23 7.7 AY825805-1|AAV70368.1| 168|Anopheles gambiae heat shock protein... 23 7.7 AY825804-1|AAV70367.1| 168|Anopheles gambiae heat shock protein... 23 7.7 AY825803-1|AAV70366.1| 168|Anopheles gambiae heat shock protein... 23 7.7 AY825802-1|AAV70365.1| 168|Anopheles gambiae heat shock protein... 23 7.7 AY825801-1|AAV70364.1| 168|Anopheles gambiae heat shock protein... 23 7.7 AY825800-1|AAV70363.1| 171|Anopheles gambiae heat shock protein... 23 7.7 AY825799-1|AAV70362.1| 171|Anopheles gambiae heat shock protein... 23 7.7 AY825798-1|AAV70361.1| 168|Anopheles gambiae heat shock protein... 23 7.7 AY825797-1|AAV70360.1| 168|Anopheles gambiae heat shock protein... 23 7.7 AY825796-1|AAV70359.1| 174|Anopheles gambiae heat shock protein... 23 7.7 AY825795-1|AAV70358.1| 174|Anopheles gambiae heat shock protein... 23 7.7 AY825794-1|AAV70357.1| 169|Anopheles gambiae heat shock protein... 23 7.7 AY825793-1|AAV70356.1| 169|Anopheles gambiae heat shock protein... 23 7.7 AY825792-1|AAV70355.1| 153|Anopheles gambiae heat shock protein... 23 7.7 AY825791-1|AAV70354.1| 153|Anopheles gambiae heat shock protein... 23 7.7 AY825790-1|AAV70353.1| 168|Anopheles gambiae heat shock protein... 23 7.7 AY825789-1|AAV70352.1| 168|Anopheles gambiae heat shock protein... 23 7.7 AY825788-1|AAV70351.1| 168|Anopheles gambiae heat shock protein... 23 7.7 AY825787-1|AAV70350.1| 168|Anopheles gambiae heat shock protein... 23 7.7 AY825786-1|AAV70349.1| 168|Anopheles gambiae heat shock protein... 23 7.7 AY825785-1|AAV70348.1| 168|Anopheles gambiae heat shock protein... 23 7.7 AY825784-1|AAV70347.1| 168|Anopheles gambiae heat shock protein... 23 7.7 AY825783-1|AAV70346.1| 168|Anopheles gambiae heat shock protein... 23 7.7 AY825782-1|AAV70345.1| 168|Anopheles gambiae heat shock protein... 23 7.7 AY825781-1|AAV70344.1| 168|Anopheles gambiae heat shock protein... 23 7.7 AY748841-1|AAV28189.1| 158|Anopheles gambiae cytochrome P450 pr... 23 7.7 AY341174-1|AAR13738.1| 280|Anopheles gambiae fibrinogen protein. 23 7.7 AY341173-1|AAR13737.1| 280|Anopheles gambiae fibrinogen protein. 23 7.7 AY341172-1|AAR13736.1| 280|Anopheles gambiae fibrinogen protein. 23 7.7 AY341171-1|AAR13735.1| 280|Anopheles gambiae fibrinogen protein. 23 7.7 AY341170-1|AAR13734.1| 280|Anopheles gambiae fibrinogen protein. 23 7.7 AY341169-1|AAR13733.1| 280|Anopheles gambiae fibrinogen protein. 23 7.7 AY341168-1|AAR13732.1| 280|Anopheles gambiae fibrinogen protein. 23 7.7 >M93690-2|AAA29363.1| 1212|Anopheles gambiae unknown protein. Length = 1212 Score = 27.1 bits (57), Expect = 0.47 Identities = 10/22 (45%), Positives = 15/22 (68%) Frame = +3 Query: 18 ASGRRPRLALPCVPVSCVIPLK 83 A +RPRL++ C P C+ PL+ Sbjct: 1 ARPQRPRLSVTCRPTKCLHPLR 22 >AY939827-1|AAY18208.1| 680|Anopheles gambiae CTCF-like protein protein. Length = 680 Score = 25.0 bits (52), Expect = 1.9 Identities = 12/30 (40%), Positives = 15/30 (50%) Frame = -3 Query: 553 CIARFALSNSLERHPSMSTV*KLSCGTCRL 464 C ARF SNSL+ H + V C+L Sbjct: 273 CFARFTQSNSLKAHKMIHQVGNKPVFQCKL 302 >AY028782-1|AAK32956.1| 501|Anopheles gambiae cytochrome P450 protein. Length = 501 Score = 25.0 bits (52), Expect = 1.9 Identities = 11/31 (35%), Positives = 19/31 (61%) Frame = -1 Query: 189 RLGHFVSRLARNQIIFHLFVSTTCWFARRVH 97 R+G V + R +I+ F++T F+RR+H Sbjct: 204 RMGRKVFEVPRGRILKFFFMATFKDFSRRIH 234 >AY545988-1|AAS99341.1| 423|Anopheles gambiae carboxypeptidase B precursor protein. Length = 423 Score = 24.6 bits (51), Expect = 2.5 Identities = 9/24 (37%), Positives = 16/24 (66%) Frame = -1 Query: 261 GSHLRDFGGIIIVNFIVHRWFVSH 190 G H R++ G++ V +++H FV H Sbjct: 185 GIHAREWAGVMSVMYMIHE-FVEH 207 >AY062432-1|AAL47188.1| 391|Anopheles gambiae putative odorant receptor Or5 protein. Length = 391 Score = 24.6 bits (51), Expect = 2.5 Identities = 12/43 (27%), Positives = 21/43 (48%) Frame = -1 Query: 189 RLGHFVSRLARNQIIFHLFVSTTCWFARRVHTSSAFLGV*HRT 61 R+ H + R ++ HL ++ W A T A+LG +R+ Sbjct: 117 RINHRIDRFSKIYCCSHLCLAIFYWVAPSSSTYLAYLGARNRS 159 >AM085517-1|CAJ30215.1| 339|Anopheles gambiae putative angiotensin converting enzymeprecursor protein. Length = 339 Score = 24.6 bits (51), Expect = 2.5 Identities = 13/32 (40%), Positives = 16/32 (50%), Gaps = 1/32 (3%) Frame = -1 Query: 330 WNPCDPRSSARSPPDTRTRSCRQ-GSHLRDFG 238 +NP DP R+PPD R Q + RD G Sbjct: 206 YNPNDPSFGGRNPPDPNYRGPGQRDPNYRDQG 237 >AJ627286-1|CAF28572.1| 423|Anopheles gambiae carboxypeptidase B protein. Length = 423 Score = 24.6 bits (51), Expect = 2.5 Identities = 9/24 (37%), Positives = 16/24 (66%) Frame = -1 Query: 261 GSHLRDFGGIIIVNFIVHRWFVSH 190 G H R++ G++ V +++H FV H Sbjct: 185 GIHAREWAGVMSVMYMIHE-FVEH 207 >AY578803-1|AAT07308.1| 474|Anopheles gambiae mothers against Dpp protein. Length = 474 Score = 23.4 bits (48), Expect = 5.8 Identities = 8/21 (38%), Positives = 11/21 (52%) Frame = -2 Query: 161 HAIKLFFTCSYPLHAGSRDEC 99 H +K TC YP A ++ C Sbjct: 115 HELKPIETCQYPFSAKQKEVC 135 >AY825832-1|AAV70395.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.0 bits (47), Expect = 7.7 Identities = 9/22 (40%), Positives = 14/22 (63%), Gaps = 1/22 (4%) Frame = +3 Query: 441 YYD-HIRPRRRHVPQLSFYTVD 503 YY+ +I P+ RH PQ+ + D Sbjct: 79 YYETNIVPKSRHTPQIIMFYAD 100 >AY825831-1|AAV70394.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.0 bits (47), Expect = 7.7 Identities = 9/22 (40%), Positives = 14/22 (63%), Gaps = 1/22 (4%) Frame = +3 Query: 441 YYD-HIRPRRRHVPQLSFYTVD 503 YY+ +I P+ RH PQ+ + D Sbjct: 79 YYETNIVPKSRHTPQIIMFYAD 100 >AY825830-1|AAV70393.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 23.0 bits (47), Expect = 7.7 Identities = 9/22 (40%), Positives = 14/22 (63%), Gaps = 1/22 (4%) Frame = +3 Query: 441 YYD-HIRPRRRHVPQLSFYTVD 503 YY+ +I P+ RH PQ+ + D Sbjct: 80 YYETNIVPKSRHTPQIIMFYAD 101 >AY825829-1|AAV70392.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 23.0 bits (47), Expect = 7.7 Identities = 9/22 (40%), Positives = 14/22 (63%), Gaps = 1/22 (4%) Frame = +3 Query: 441 YYD-HIRPRRRHVPQLSFYTVD 503 YY+ +I P+ RH PQ+ + D Sbjct: 80 YYETNIVPKSRHTPQIIMFYAD 101 >AY825828-1|AAV70391.1| 172|Anopheles gambiae heat shock protein DnaJ protein. Length = 172 Score = 23.0 bits (47), Expect = 7.7 Identities = 9/22 (40%), Positives = 14/22 (63%), Gaps = 1/22 (4%) Frame = +3 Query: 441 YYD-HIRPRRRHVPQLSFYTVD 503 YY+ +I P+ RH PQ+ + D Sbjct: 80 YYETNIVPKSRHTPQIIMFYAD 101 >AY825827-1|AAV70390.1| 172|Anopheles gambiae heat shock protein DnaJ protein. Length = 172 Score = 23.0 bits (47), Expect = 7.7 Identities = 9/22 (40%), Positives = 14/22 (63%), Gaps = 1/22 (4%) Frame = +3 Query: 441 YYD-HIRPRRRHVPQLSFYTVD 503 YY+ +I P+ RH PQ+ + D Sbjct: 80 YYETNIVPKSRHTPQIIMFYAD 101 >AY825826-1|AAV70389.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 23.0 bits (47), Expect = 7.7 Identities = 9/22 (40%), Positives = 14/22 (63%), Gaps = 1/22 (4%) Frame = +3 Query: 441 YYD-HIRPRRRHVPQLSFYTVD 503 YY+ +I P+ RH PQ+ + D Sbjct: 80 YYETNIVPKSRHTPQIIMFYAD 101 >AY825825-1|AAV70388.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 23.0 bits (47), Expect = 7.7 Identities = 9/22 (40%), Positives = 14/22 (63%), Gaps = 1/22 (4%) Frame = +3 Query: 441 YYD-HIRPRRRHVPQLSFYTVD 503 YY+ +I P+ RH PQ+ + D Sbjct: 80 YYETNIVPKSRHTPQIIMFYAD 101 >AY825824-1|AAV70387.1| 161|Anopheles gambiae heat shock protein DnaJ protein. Length = 161 Score = 23.0 bits (47), Expect = 7.7 Identities = 9/22 (40%), Positives = 14/22 (63%), Gaps = 1/22 (4%) Frame = +3 Query: 441 YYD-HIRPRRRHVPQLSFYTVD 503 YY+ +I P+ RH PQ+ + D Sbjct: 65 YYETNIVPKSRHTPQIIMFYAD 86 >AY825823-1|AAV70386.1| 161|Anopheles gambiae heat shock protein DnaJ protein. Length = 161 Score = 23.0 bits (47), Expect = 7.7 Identities = 9/22 (40%), Positives = 14/22 (63%), Gaps = 1/22 (4%) Frame = +3 Query: 441 YYD-HIRPRRRHVPQLSFYTVD 503 YY+ +I P+ RH PQ+ + D Sbjct: 65 YYETNIVPKSRHTPQIIMFYAD 86 >AY825822-1|AAV70385.1| 159|Anopheles gambiae heat shock protein DnaJ protein. Length = 159 Score = 23.0 bits (47), Expect = 7.7 Identities = 9/22 (40%), Positives = 14/22 (63%), Gaps = 1/22 (4%) Frame = +3 Query: 441 YYD-HIRPRRRHVPQLSFYTVD 503 YY+ +I P+ RH PQ+ + D Sbjct: 67 YYETNIVPKSRHTPQIIMFYAD 88 >AY825821-1|AAV70384.1| 159|Anopheles gambiae heat shock protein DnaJ protein. Length = 159 Score = 23.0 bits (47), Expect = 7.7 Identities = 9/22 (40%), Positives = 14/22 (63%), Gaps = 1/22 (4%) Frame = +3 Query: 441 YYD-HIRPRRRHVPQLSFYTVD 503 YY+ +I P+ RH PQ+ + D Sbjct: 67 YYETNIVPKSRHTPQIIMFYAD 88 >AY825820-1|AAV70383.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.0 bits (47), Expect = 7.7 Identities = 9/22 (40%), Positives = 14/22 (63%), Gaps = 1/22 (4%) Frame = +3 Query: 441 YYD-HIRPRRRHVPQLSFYTVD 503 YY+ +I P+ RH PQ+ + D Sbjct: 79 YYETNIVPKSRHTPQIIMFYAD 100 >AY825819-1|AAV70382.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.0 bits (47), Expect = 7.7 Identities = 9/22 (40%), Positives = 14/22 (63%), Gaps = 1/22 (4%) Frame = +3 Query: 441 YYD-HIRPRRRHVPQLSFYTVD 503 YY+ +I P+ RH PQ+ + D Sbjct: 79 YYETNIVPKSRHTPQIIMFYAD 100 >AY825818-1|AAV70381.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.0 bits (47), Expect = 7.7 Identities = 9/22 (40%), Positives = 14/22 (63%), Gaps = 1/22 (4%) Frame = +3 Query: 441 YYD-HIRPRRRHVPQLSFYTVD 503 YY+ +I P+ RH PQ+ + D Sbjct: 79 YYETNIVPKSRHTPQIIMFYAD 100 >AY825817-1|AAV70380.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.0 bits (47), Expect = 7.7 Identities = 9/22 (40%), Positives = 14/22 (63%), Gaps = 1/22 (4%) Frame = +3 Query: 441 YYD-HIRPRRRHVPQLSFYTVD 503 YY+ +I P+ RH PQ+ + D Sbjct: 79 YYETNIVPKSRHTPQIIMFYAD 100 >AY825816-1|AAV70379.1| 162|Anopheles gambiae heat shock protein DnaJ protein. Length = 162 Score = 23.0 bits (47), Expect = 7.7 Identities = 9/22 (40%), Positives = 14/22 (63%), Gaps = 1/22 (4%) Frame = +3 Query: 441 YYD-HIRPRRRHVPQLSFYTVD 503 YY+ +I P+ RH PQ+ + D Sbjct: 70 YYETNIVPKSRHTPQIIMFYAD 91 >AY825815-1|AAV70378.1| 162|Anopheles gambiae heat shock protein DnaJ protein. Length = 162 Score = 23.0 bits (47), Expect = 7.7 Identities = 9/22 (40%), Positives = 14/22 (63%), Gaps = 1/22 (4%) Frame = +3 Query: 441 YYD-HIRPRRRHVPQLSFYTVD 503 YY+ +I P+ RH PQ+ + D Sbjct: 70 YYETNIVPKSRHTPQIIMFYAD 91 >AY825814-1|AAV70377.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 23.0 bits (47), Expect = 7.7 Identities = 9/22 (40%), Positives = 14/22 (63%), Gaps = 1/22 (4%) Frame = +3 Query: 441 YYD-HIRPRRRHVPQLSFYTVD 503 YY+ +I P+ RH PQ+ + D Sbjct: 80 YYETNIVPKSRHTPQIIMFYAD 101 >AY825813-1|AAV70376.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 23.0 bits (47), Expect = 7.7 Identities = 9/22 (40%), Positives = 14/22 (63%), Gaps = 1/22 (4%) Frame = +3 Query: 441 YYD-HIRPRRRHVPQLSFYTVD 503 YY+ +I P+ RH PQ+ + D Sbjct: 80 YYETNIVPKSRHTPQIIMFYAD 101 >AY825812-1|AAV70375.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.0 bits (47), Expect = 7.7 Identities = 9/22 (40%), Positives = 14/22 (63%), Gaps = 1/22 (4%) Frame = +3 Query: 441 YYD-HIRPRRRHVPQLSFYTVD 503 YY+ +I P+ RH PQ+ + D Sbjct: 79 YYETNIVPKSRHTPQIIMFYAD 100 >AY825811-1|AAV70374.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.0 bits (47), Expect = 7.7 Identities = 9/22 (40%), Positives = 14/22 (63%), Gaps = 1/22 (4%) Frame = +3 Query: 441 YYD-HIRPRRRHVPQLSFYTVD 503 YY+ +I P+ RH PQ+ + D Sbjct: 79 YYETNIVPKSRHTPQIIMFYAD 100 >AY825810-1|AAV70373.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 23.0 bits (47), Expect = 7.7 Identities = 9/22 (40%), Positives = 14/22 (63%), Gaps = 1/22 (4%) Frame = +3 Query: 441 YYD-HIRPRRRHVPQLSFYTVD 503 YY+ +I P+ RH PQ+ + D Sbjct: 80 YYETNIVPKSRHTPQIIMFYAD 101 >AY825809-1|AAV70372.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 23.0 bits (47), Expect = 7.7 Identities = 9/22 (40%), Positives = 14/22 (63%), Gaps = 1/22 (4%) Frame = +3 Query: 441 YYD-HIRPRRRHVPQLSFYTVD 503 YY+ +I P+ RH PQ+ + D Sbjct: 80 YYETNIVPKSRHTPQIIMFYAD 101 >AY825808-1|AAV70371.1| 171|Anopheles gambiae heat shock protein DnaJ protein. Length = 171 Score = 23.0 bits (47), Expect = 7.7 Identities = 9/22 (40%), Positives = 14/22 (63%), Gaps = 1/22 (4%) Frame = +3 Query: 441 YYD-HIRPRRRHVPQLSFYTVD 503 YY+ +I P+ RH PQ+ + D Sbjct: 79 YYETNIVPKSRHTPQIIMFYAD 100 >AY825807-1|AAV70370.1| 171|Anopheles gambiae heat shock protein DnaJ protein. Length = 171 Score = 23.0 bits (47), Expect = 7.7 Identities = 9/22 (40%), Positives = 14/22 (63%), Gaps = 1/22 (4%) Frame = +3 Query: 441 YYD-HIRPRRRHVPQLSFYTVD 503 YY+ +I P+ RH PQ+ + D Sbjct: 79 YYETNIVPKSRHTPQIIMFYAD 100 >AY825806-1|AAV70369.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.0 bits (47), Expect = 7.7 Identities = 9/22 (40%), Positives = 14/22 (63%), Gaps = 1/22 (4%) Frame = +3 Query: 441 YYD-HIRPRRRHVPQLSFYTVD 503 YY+ +I P+ RH PQ+ + D Sbjct: 79 YYETNIVPKSRHTPQIIMFYAD 100 >AY825805-1|AAV70368.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.0 bits (47), Expect = 7.7 Identities = 9/22 (40%), Positives = 14/22 (63%), Gaps = 1/22 (4%) Frame = +3 Query: 441 YYD-HIRPRRRHVPQLSFYTVD 503 YY+ +I P+ RH PQ+ + D Sbjct: 79 YYETNIVPKSRHTPQIIMFYAD 100 >AY825804-1|AAV70367.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.0 bits (47), Expect = 7.7 Identities = 9/22 (40%), Positives = 14/22 (63%), Gaps = 1/22 (4%) Frame = +3 Query: 441 YYD-HIRPRRRHVPQLSFYTVD 503 YY+ +I P+ RH PQ+ + D Sbjct: 79 YYETNIVPKSRHTPQIIMFYAD 100 >AY825803-1|AAV70366.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.0 bits (47), Expect = 7.7 Identities = 9/22 (40%), Positives = 14/22 (63%), Gaps = 1/22 (4%) Frame = +3 Query: 441 YYD-HIRPRRRHVPQLSFYTVD 503 YY+ +I P+ RH PQ+ + D Sbjct: 79 YYETNIVPKSRHTPQIIMFYAD 100 >AY825802-1|AAV70365.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.0 bits (47), Expect = 7.7 Identities = 9/22 (40%), Positives = 14/22 (63%), Gaps = 1/22 (4%) Frame = +3 Query: 441 YYD-HIRPRRRHVPQLSFYTVD 503 YY+ +I P+ RH PQ+ + D Sbjct: 79 YYETNIVPKSRHTPQIIMFYAD 100 >AY825801-1|AAV70364.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.0 bits (47), Expect = 7.7 Identities = 9/22 (40%), Positives = 14/22 (63%), Gaps = 1/22 (4%) Frame = +3 Query: 441 YYD-HIRPRRRHVPQLSFYTVD 503 YY+ +I P+ RH PQ+ + D Sbjct: 79 YYETNIVPKSRHTPQIIMFYAD 100 >AY825800-1|AAV70363.1| 171|Anopheles gambiae heat shock protein DnaJ protein. Length = 171 Score = 23.0 bits (47), Expect = 7.7 Identities = 9/22 (40%), Positives = 14/22 (63%), Gaps = 1/22 (4%) Frame = +3 Query: 441 YYD-HIRPRRRHVPQLSFYTVD 503 YY+ +I P+ RH PQ+ + D Sbjct: 80 YYETNIVPKSRHTPQIIMFYAD 101 >AY825799-1|AAV70362.1| 171|Anopheles gambiae heat shock protein DnaJ protein. Length = 171 Score = 23.0 bits (47), Expect = 7.7 Identities = 9/22 (40%), Positives = 14/22 (63%), Gaps = 1/22 (4%) Frame = +3 Query: 441 YYD-HIRPRRRHVPQLSFYTVD 503 YY+ +I P+ RH PQ+ + D Sbjct: 80 YYETNIVPKSRHTPQIIMFYAD 101 >AY825798-1|AAV70361.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.0 bits (47), Expect = 7.7 Identities = 9/22 (40%), Positives = 14/22 (63%), Gaps = 1/22 (4%) Frame = +3 Query: 441 YYD-HIRPRRRHVPQLSFYTVD 503 YY+ +I P+ RH PQ+ + D Sbjct: 79 YYETNIVPKSRHTPQIIMFYAD 100 >AY825797-1|AAV70360.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.0 bits (47), Expect = 7.7 Identities = 9/22 (40%), Positives = 14/22 (63%), Gaps = 1/22 (4%) Frame = +3 Query: 441 YYD-HIRPRRRHVPQLSFYTVD 503 YY+ +I P+ RH PQ+ + D Sbjct: 79 YYETNIVPKSRHTPQIIMFYAD 100 >AY825796-1|AAV70359.1| 174|Anopheles gambiae heat shock protein DnaJ protein. Length = 174 Score = 23.0 bits (47), Expect = 7.7 Identities = 9/22 (40%), Positives = 14/22 (63%), Gaps = 1/22 (4%) Frame = +3 Query: 441 YYD-HIRPRRRHVPQLSFYTVD 503 YY+ +I P+ RH PQ+ + D Sbjct: 82 YYETNIVPKSRHTPQIIMFYAD 103 >AY825795-1|AAV70358.1| 174|Anopheles gambiae heat shock protein DnaJ protein. Length = 174 Score = 23.0 bits (47), Expect = 7.7 Identities = 9/22 (40%), Positives = 14/22 (63%), Gaps = 1/22 (4%) Frame = +3 Query: 441 YYD-HIRPRRRHVPQLSFYTVD 503 YY+ +I P+ RH PQ+ + D Sbjct: 82 YYETNIVPKSRHTPQIIMFYAD 103 >AY825794-1|AAV70357.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 23.0 bits (47), Expect = 7.7 Identities = 9/22 (40%), Positives = 14/22 (63%), Gaps = 1/22 (4%) Frame = +3 Query: 441 YYD-HIRPRRRHVPQLSFYTVD 503 YY+ +I P+ RH PQ+ + D Sbjct: 79 YYETNIVPKSRHTPQIIMFYAD 100 >AY825793-1|AAV70356.1| 169|Anopheles gambiae heat shock protein DnaJ protein. Length = 169 Score = 23.0 bits (47), Expect = 7.7 Identities = 9/22 (40%), Positives = 14/22 (63%), Gaps = 1/22 (4%) Frame = +3 Query: 441 YYD-HIRPRRRHVPQLSFYTVD 503 YY+ +I P+ RH PQ+ + D Sbjct: 79 YYETNIVPKSRHTPQIIMFYAD 100 >AY825792-1|AAV70355.1| 153|Anopheles gambiae heat shock protein DnaJ protein. Length = 153 Score = 23.0 bits (47), Expect = 7.7 Identities = 9/22 (40%), Positives = 14/22 (63%), Gaps = 1/22 (4%) Frame = +3 Query: 441 YYD-HIRPRRRHVPQLSFYTVD 503 YY+ +I P+ RH PQ+ + D Sbjct: 64 YYETNIVPKSRHTPQIIMFYAD 85 >AY825791-1|AAV70354.1| 153|Anopheles gambiae heat shock protein DnaJ protein. Length = 153 Score = 23.0 bits (47), Expect = 7.7 Identities = 9/22 (40%), Positives = 14/22 (63%), Gaps = 1/22 (4%) Frame = +3 Query: 441 YYD-HIRPRRRHVPQLSFYTVD 503 YY+ +I P+ RH PQ+ + D Sbjct: 64 YYETNIVPKSRHTPQIIMFYAD 85 >AY825790-1|AAV70353.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.0 bits (47), Expect = 7.7 Identities = 9/22 (40%), Positives = 14/22 (63%), Gaps = 1/22 (4%) Frame = +3 Query: 441 YYD-HIRPRRRHVPQLSFYTVD 503 YY+ +I P+ RH PQ+ + D Sbjct: 79 YYETNIVPKSRHTPQIIMFYAD 100 >AY825789-1|AAV70352.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.0 bits (47), Expect = 7.7 Identities = 9/22 (40%), Positives = 14/22 (63%), Gaps = 1/22 (4%) Frame = +3 Query: 441 YYD-HIRPRRRHVPQLSFYTVD 503 YY+ +I P+ RH PQ+ + D Sbjct: 79 YYETNIVPKSRHTPQIIMFYAD 100 >AY825788-1|AAV70351.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.0 bits (47), Expect = 7.7 Identities = 9/22 (40%), Positives = 14/22 (63%), Gaps = 1/22 (4%) Frame = +3 Query: 441 YYD-HIRPRRRHVPQLSFYTVD 503 YY+ +I P+ RH PQ+ + D Sbjct: 79 YYETNIVPKSRHTPQIIMFYAD 100 >AY825787-1|AAV70350.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.0 bits (47), Expect = 7.7 Identities = 9/22 (40%), Positives = 14/22 (63%), Gaps = 1/22 (4%) Frame = +3 Query: 441 YYD-HIRPRRRHVPQLSFYTVD 503 YY+ +I P+ RH PQ+ + D Sbjct: 79 YYETNIVPKSRHTPQIIMFYAD 100 >AY825786-1|AAV70349.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.0 bits (47), Expect = 7.7 Identities = 9/22 (40%), Positives = 14/22 (63%), Gaps = 1/22 (4%) Frame = +3 Query: 441 YYD-HIRPRRRHVPQLSFYTVD 503 YY+ +I P+ RH PQ+ + D Sbjct: 79 YYETNIVPKSRHTPQIIMFYAD 100 >AY825785-1|AAV70348.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.0 bits (47), Expect = 7.7 Identities = 9/22 (40%), Positives = 14/22 (63%), Gaps = 1/22 (4%) Frame = +3 Query: 441 YYD-HIRPRRRHVPQLSFYTVD 503 YY+ +I P+ RH PQ+ + D Sbjct: 79 YYETNIVPKSRHTPQIIMFYAD 100 >AY825784-1|AAV70347.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.0 bits (47), Expect = 7.7 Identities = 9/22 (40%), Positives = 14/22 (63%), Gaps = 1/22 (4%) Frame = +3 Query: 441 YYD-HIRPRRRHVPQLSFYTVD 503 YY+ +I P+ RH PQ+ + D Sbjct: 79 YYETNIVPKSRHTPQIIMFYAD 100 >AY825783-1|AAV70346.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.0 bits (47), Expect = 7.7 Identities = 9/22 (40%), Positives = 14/22 (63%), Gaps = 1/22 (4%) Frame = +3 Query: 441 YYD-HIRPRRRHVPQLSFYTVD 503 YY+ +I P+ RH PQ+ + D Sbjct: 79 YYETNIVPKSRHTPQIIMFYAD 100 >AY825782-1|AAV70345.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.0 bits (47), Expect = 7.7 Identities = 9/22 (40%), Positives = 14/22 (63%), Gaps = 1/22 (4%) Frame = +3 Query: 441 YYD-HIRPRRRHVPQLSFYTVD 503 YY+ +I P+ RH PQ+ + D Sbjct: 79 YYETNIVPKSRHTPQIIMFYAD 100 >AY825781-1|AAV70344.1| 168|Anopheles gambiae heat shock protein DnaJ protein. Length = 168 Score = 23.0 bits (47), Expect = 7.7 Identities = 9/22 (40%), Positives = 14/22 (63%), Gaps = 1/22 (4%) Frame = +3 Query: 441 YYD-HIRPRRRHVPQLSFYTVD 503 YY+ +I P+ RH PQ+ + D Sbjct: 79 YYETNIVPKSRHTPQIIMFYAD 100 >AY748841-1|AAV28189.1| 158|Anopheles gambiae cytochrome P450 protein. Length = 158 Score = 23.0 bits (47), Expect = 7.7 Identities = 10/42 (23%), Positives = 21/42 (50%) Frame = +2 Query: 434 GRVLRSHPAEEAARATAQLLHRRHRRMTLEAIAQSESSYTSS 559 G +++ ++ +A A + RH R +E ++E YT + Sbjct: 46 GYIVQHPEVQQRIQAEADGVLERHGRQVIELTDRAEMQYTEA 87 >AY341174-1|AAR13738.1| 280|Anopheles gambiae fibrinogen protein. Length = 280 Score = 23.0 bits (47), Expect = 7.7 Identities = 7/11 (63%), Positives = 8/11 (72%) Frame = -3 Query: 259 VTSPGFWWYHN 227 VT G WWY+N Sbjct: 262 VTCEGAWWYNN 272 >AY341173-1|AAR13737.1| 280|Anopheles gambiae fibrinogen protein. Length = 280 Score = 23.0 bits (47), Expect = 7.7 Identities = 7/11 (63%), Positives = 8/11 (72%) Frame = -3 Query: 259 VTSPGFWWYHN 227 VT G WWY+N Sbjct: 262 VTCEGAWWYNN 272 >AY341172-1|AAR13736.1| 280|Anopheles gambiae fibrinogen protein. Length = 280 Score = 23.0 bits (47), Expect = 7.7 Identities = 7/11 (63%), Positives = 8/11 (72%) Frame = -3 Query: 259 VTSPGFWWYHN 227 VT G WWY+N Sbjct: 262 VTCEGAWWYNN 272 >AY341171-1|AAR13735.1| 280|Anopheles gambiae fibrinogen protein. Length = 280 Score = 23.0 bits (47), Expect = 7.7 Identities = 7/11 (63%), Positives = 8/11 (72%) Frame = -3 Query: 259 VTSPGFWWYHN 227 VT G WWY+N Sbjct: 262 VTCEGAWWYNN 272 >AY341170-1|AAR13734.1| 280|Anopheles gambiae fibrinogen protein. Length = 280 Score = 23.0 bits (47), Expect = 7.7 Identities = 7/11 (63%), Positives = 8/11 (72%) Frame = -3 Query: 259 VTSPGFWWYHN 227 VT G WWY+N Sbjct: 262 VTCEGAWWYNN 272 >AY341169-1|AAR13733.1| 280|Anopheles gambiae fibrinogen protein. Length = 280 Score = 23.0 bits (47), Expect = 7.7 Identities = 7/11 (63%), Positives = 8/11 (72%) Frame = -3 Query: 259 VTSPGFWWYHN 227 VT G WWY+N Sbjct: 262 VTCEGAWWYNN 272 >AY341168-1|AAR13732.1| 280|Anopheles gambiae fibrinogen protein. Length = 280 Score = 23.0 bits (47), Expect = 7.7 Identities = 7/11 (63%), Positives = 8/11 (72%) Frame = -3 Query: 259 VTSPGFWWYHN 227 VT G WWY+N Sbjct: 262 VTCEGAWWYNN 272 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 511,571 Number of Sequences: 2352 Number of extensions: 8476 Number of successful extensions: 86 Number of sequences better than 10.0: 68 Number of HSP's better than 10.0 without gapping: 86 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 86 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 59291487 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -