BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0841 (608 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY957503-1|AAY41942.1| 596|Anopheles gambiae vasa-like protein ... 26 1.1 AY578799-1|AAT07304.1| 679|Anopheles gambiae brinker protein. 25 1.9 AJ416109-1|CAC94781.1| 234|Anopheles gambiae PROSAg25 protein p... 23 5.8 >AY957503-1|AAY41942.1| 596|Anopheles gambiae vasa-like protein protein. Length = 596 Score = 25.8 bits (54), Expect = 1.1 Identities = 22/88 (25%), Positives = 35/88 (39%) Frame = +2 Query: 188 RGEKG*DPTAQGNARRSTYRLRGLKTVKILKKPEPTVGEGEVLIRVKACGLNFQDLIVRQ 367 R G P GN+ S +++ K ++ P PT E + + G+NF Q Sbjct: 102 RNGDGGRPAYSGNSDPSMDQVKTDKPRELYIPPLPTEDESLIFGSGISSGINFDKFEEIQ 161 Query: 368 GAIDSPPKTPFILGFECAGEIEQVGENV 451 + + FE +G E+V NV Sbjct: 162 VRVSGENPPDHVESFERSGLREEVMTNV 189 >AY578799-1|AAT07304.1| 679|Anopheles gambiae brinker protein. Length = 679 Score = 25.0 bits (52), Expect = 1.9 Identities = 12/40 (30%), Positives = 16/40 (40%), Gaps = 1/40 (2%) Frame = -2 Query: 574 QHPGQTFLRAARTR-TGPVQTPAGPSAVLGESHHLVAHLK 458 Q P F R + P P P GES+H H++ Sbjct: 283 QQPSVIFSPVPRLAGSSPAAAPPSPPTSAGESNHYYGHIR 322 >AJ416109-1|CAC94781.1| 234|Anopheles gambiae PROSAg25 protein protein. Length = 234 Score = 23.4 bits (48), Expect = 5.8 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = -3 Query: 510 LAQARYSGRATTWSPTLKLV 451 +A RYS TT+SP+ KLV Sbjct: 1 MASERYSFSLTTFSPSGKLV 20 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 611,596 Number of Sequences: 2352 Number of extensions: 13317 Number of successful extensions: 12 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 59291487 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -