BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= ce--0840
(687 letters)
Database: uniref50
1,657,284 sequences; 575,637,011 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
UniRef50_Q5CTQ0 Cluster: Putative uncharacterized protein; n=2; ... 33 8.6
>UniRef50_Q5CTQ0 Cluster: Putative uncharacterized protein; n=2;
Cryptosporidium|Rep: Putative uncharacterized protein -
Cryptosporidium parvum Iowa II
Length = 1818
Score = 32.7 bits (71), Expect = 8.6
Identities = 16/55 (29%), Positives = 30/55 (54%)
Frame = +3
Query: 213 FYSLFILYILTKFFQPNNTYQIVSHLLSVNNEILQSVLMSPEXXXXXXXLLHNLR 377
FY + + ++TK QPN Y S + S+ N +L+S +P+ +L+N++
Sbjct: 45 FYLIIFMIVITKVIQPNEEY---SSIYSIQN-VLKSANWNPDLSTPKNSMLYNIQ 95
Database: uniref50
Posted date: Oct 5, 2007 11:19 AM
Number of letters in database: 575,637,011
Number of sequences in database: 1,657,284
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 530,546,169
Number of Sequences: 1657284
Number of extensions: 9193402
Number of successful extensions: 19612
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 18417
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 19553
length of database: 575,637,011
effective HSP length: 98
effective length of database: 413,223,179
effective search space used: 53719013270
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -