BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0840 (687 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC25G10.08 |||translation initiation factor eIF3b |Schizosacch... 26 4.4 SPAC17A5.16 |||human down-regulated in multiple cancers-1 homolo... 26 4.4 SPAC56F8.02 |||AMP binding enzyme |Schizosaccharomyces pombe|chr... 25 7.8 >SPAC25G10.08 |||translation initiation factor eIF3b |Schizosaccharomyces pombe|chr 1|||Manual Length = 725 Score = 26.2 bits (55), Expect = 4.4 Identities = 12/53 (22%), Positives = 24/53 (45%) Frame = +3 Query: 249 FFQPNNTYQIVSHLLSVNNEILQSVLMSPEXXXXXXXLLHNLRKSDSRFYSIE 407 F Q NT H+++ + + S+ M+P+ L + + D FY ++ Sbjct: 495 FEQKKNTPSTFRHIITFDKKTCNSLFMAPKGRFMVAATLGSSTQYDLEFYDLD 547 >SPAC17A5.16 |||human down-regulated in multiple cancers-1 homolog 3|Schizosaccharomyces pombe|chr 1|||Manual Length = 925 Score = 26.2 bits (55), Expect = 4.4 Identities = 13/43 (30%), Positives = 21/43 (48%) Frame = +2 Query: 134 TSVNTNITIYHWTFTQEMDKHEMLTFILFIIHSLYSHKVLSTK 262 T T+I Y + ++ + ++ LFI+H L KVL K Sbjct: 456 TEFLTSIQFYALRYREDNEHSGLVRICLFIVHYLSCEKVLCEK 498 >SPAC56F8.02 |||AMP binding enzyme |Schizosaccharomyces pombe|chr 1|||Manual Length = 1517 Score = 25.4 bits (53), Expect = 7.8 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = +3 Query: 135 HPSIQTLQYITGHSHKKWINMKC 203 + + QTL YI KW N+ C Sbjct: 1159 YATFQTLNYIQNQQPTKWPNLSC 1181 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,417,064 Number of Sequences: 5004 Number of extensions: 44713 Number of successful extensions: 106 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 106 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 106 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 317927284 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -