BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0840 (687 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 12_02_0803 + 23318429-23318552,23318688-23319877,23320724-233215... 30 2.0 09_04_0497 - 18096299-18096496,18096586-18096675,18096809-180969... 28 6.0 08_02_1073 - 24117834-24118037,24118122-24118211,24118299-241184... 28 8.0 >12_02_0803 + 23318429-23318552,23318688-23319877,23320724-23321528, 23321938-23322417,23322535-23322815,23323207-23323302, 23323423-23323548,23324100-23325890 Length = 1630 Score = 29.9 bits (64), Expect = 2.0 Identities = 18/59 (30%), Positives = 33/59 (55%) Frame = +3 Query: 156 QYITGHSHKKWINMKC*HSFYSLFILYILTKFFQPNNTYQIVSHLLSVNNEILQSVLMS 332 Q++ H+ +K + K +S +I Y L + P TY++ S+L+ + ++QSVL S Sbjct: 845 QHVEHHAWRKSKHTKHSKPSFSGWIPYGLFQHILPVPTYRVGSNLIRADLNLIQSVLAS 903 >09_04_0497 - 18096299-18096496,18096586-18096675,18096809-18096914, 18097005-18097179,18097263-18097365,18097458-18097712, 18097791-18097868,18097986-18098078,18098179-18098319, 18098406-18098510,18098658-18098738,18098825-18098866, 18098966-18099082,18099208-18099351,18099485-18099568, 18099683-18099803,18099863-18099988,18100106-18100179, 18100388-18100657 Length = 800 Score = 28.3 bits (60), Expect = 6.0 Identities = 11/27 (40%), Positives = 18/27 (66%) Frame = +2 Query: 197 EMLTFILFIIHSLYSHKVLSTKQYISN 277 E+ + I+HSLYSHK + ++ +SN Sbjct: 90 EVSRLLDLIVHSLYSHKEVFLRELVSN 116 >08_02_1073 - 24117834-24118037,24118122-24118211,24118299-24118404, 24118477-24118648,24118737-24118839,24118927-24119181, 24119259-24119336,24119449-24119541,24119660-24119800, 24119882-24119986,24120135-24120212,24120297-24120341, 24120463-24120579,24120685-24120828,24120934-24121017, 24121139-24121232,24121322-24121447,24121585-24121658, 24121870-24122098,24123124-24123611,24123702-24123749, 24123841-24124077,24124368-24124404,24125011-24125018 Length = 1051 Score = 27.9 bits (59), Expect = 8.0 Identities = 10/19 (52%), Positives = 15/19 (78%) Frame = +2 Query: 221 IIHSLYSHKVLSTKQYISN 277 I+HSLYSHK + ++ +SN Sbjct: 357 IVHSLYSHKEVFLRELVSN 375 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,785,865 Number of Sequences: 37544 Number of extensions: 200265 Number of successful extensions: 322 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 316 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 322 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1744894544 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -