BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0839 (561 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB072429-1|BAB83990.1| 388|Apis mellifera IP3phosphatase protein. 25 0.40 AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein ... 24 0.91 AB086196-1|BAD06465.1| 289|Apis mellifera Period protein. 24 0.91 AJ547798-1|CAD67999.1| 587|Apis mellifera octopamine receptor p... 23 2.1 AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso... 23 2.1 >AB072429-1|BAB83990.1| 388|Apis mellifera IP3phosphatase protein. Length = 388 Score = 25.4 bits (53), Expect = 0.40 Identities = 20/57 (35%), Positives = 28/57 (49%) Frame = -2 Query: 299 GSGYLFCSVPHLLHKVLLSHTDHHALMAGPSHDRGEHGARSIISCETGLAQYRKPLF 129 GS Y+ VP +VLL+ TD + S D E+G II T + + KP+F Sbjct: 329 GSNYMQTRVPAWCDRVLLNPTDKMLVQDISSPDAVEYG---IIGPTTCMGDH-KPVF 381 >AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein protein. Length = 1124 Score = 24.2 bits (50), Expect = 0.91 Identities = 10/24 (41%), Positives = 12/24 (50%) Frame = -2 Query: 203 DRGEHGARSIISCETGLAQYRKPL 132 D GEH ++ E GLA PL Sbjct: 130 DPGEHNGDTVTDVEAGLASRTNPL 153 >AB086196-1|BAD06465.1| 289|Apis mellifera Period protein. Length = 289 Score = 24.2 bits (50), Expect = 0.91 Identities = 10/24 (41%), Positives = 12/24 (50%) Frame = -2 Query: 203 DRGEHGARSIISCETGLAQYRKPL 132 D GEH ++ E GLA PL Sbjct: 125 DPGEHNGDTVTDVEAGLASRTNPL 148 >AJ547798-1|CAD67999.1| 587|Apis mellifera octopamine receptor protein. Length = 587 Score = 23.0 bits (47), Expect = 2.1 Identities = 7/13 (53%), Positives = 10/13 (76%) Frame = +2 Query: 479 FNTPAMYVAIKPC 517 FNT ++V +KPC Sbjct: 223 FNTTTIFVPVKPC 235 >AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor protein. Length = 1770 Score = 23.0 bits (47), Expect = 2.1 Identities = 10/26 (38%), Positives = 15/26 (57%) Frame = +2 Query: 380 LRVAPEEHPVLLTEAPLNPKANREKM 457 LR+ P H V+ T +NP + EK+ Sbjct: 1461 LRLGPCWHAVMTTYPRINPDNHNEKL 1486 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 176,635 Number of Sequences: 438 Number of extensions: 4246 Number of successful extensions: 6 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 16195212 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -