BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0838 (395 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY101765-1|AAM50084.1| 1885|Homo sapiens C3 and PZP-like alpha-2... 29 4.2 AB033109-1|BAA86597.1| 1884|Homo sapiens KIAA1283 protein protein. 29 4.2 BC050336-1|AAH50336.1| 1553|Homo sapiens FRYL protein protein. 28 9.7 BC041103-1|AAH41103.1| 160|Homo sapiens similar to RIKEN cDNA A... 28 9.7 AK128543-1|BAC87492.1| 1433|Homo sapiens protein ( Homo sapiens ... 28 9.7 AK126665-1|BAC86634.1| 1012|Homo sapiens protein ( Homo sapiens ... 28 9.7 AK095913-1|BAC04645.1| 160|Homo sapiens protein ( Homo sapiens ... 28 9.7 AB127405-1|BAD03968.1| 1183|Homo sapiens SNAP-25-interacting pro... 28 9.7 AB051471-1|BAB21775.1| 762|Homo sapiens KIAA1684 protein protein. 28 9.7 >AY101765-1|AAM50084.1| 1885|Homo sapiens C3 and PZP-like alpha-2-macroglobulin domain containing 8 protein. Length = 1885 Score = 29.5 bits (63), Expect = 4.2 Identities = 13/27 (48%), Positives = 19/27 (70%) Frame = -1 Query: 335 RSGWSLSPSQPFRQLESIDLSSKTWVS 255 RSG+ L+P+Q F++LE D+S VS Sbjct: 627 RSGFRLTPAQVFQELEDYDVSDSFGVS 653 >AB033109-1|BAA86597.1| 1884|Homo sapiens KIAA1283 protein protein. Length = 1884 Score = 29.5 bits (63), Expect = 4.2 Identities = 13/27 (48%), Positives = 19/27 (70%) Frame = -1 Query: 335 RSGWSLSPSQPFRQLESIDLSSKTWVS 255 RSG+ L+P+Q F++LE D+S VS Sbjct: 626 RSGFRLTPAQVFQELEDYDVSDSFGVS 652 >BC050336-1|AAH50336.1| 1553|Homo sapiens FRYL protein protein. Length = 1553 Score = 28.3 bits (60), Expect = 9.7 Identities = 13/39 (33%), Positives = 21/39 (53%) Frame = -2 Query: 265 PGLVSGSTSPSGVMHGPADGRGNDKLNDPYTQNSHTNLN 149 P + SG+TS S M P DG ++K + S+ +L+ Sbjct: 1474 PSVTSGTTSSSNTMVAPTDGNPDNKPIKENIEESYVHLD 1512 >BC041103-1|AAH41103.1| 160|Homo sapiens similar to RIKEN cDNA A530016L24 gene protein. Length = 160 Score = 28.3 bits (60), Expect = 9.7 Identities = 15/43 (34%), Positives = 18/43 (41%) Frame = +3 Query: 228 TPEGLVLPDTNPGLA*QINRLELSEWLRRTQRPSRTGPDPCPP 356 T G V PD+ P Q + E + W R R R CPP Sbjct: 3 TAAGAVSPDSRPETRRQTRKNEEAAWGPRVCRAEREDNRKCPP 45 >AK128543-1|BAC87492.1| 1433|Homo sapiens protein ( Homo sapiens cDNA FLJ46702 fis, clone TRACH3014183. ). Length = 1433 Score = 28.3 bits (60), Expect = 9.7 Identities = 13/39 (33%), Positives = 21/39 (53%) Frame = -2 Query: 265 PGLVSGSTSPSGVMHGPADGRGNDKLNDPYTQNSHTNLN 149 P + SG+TS S M P DG ++K + S+ +L+ Sbjct: 305 PSVTSGTTSSSNTMVAPTDGNPDNKPIKENIEESYVHLD 343 >AK126665-1|BAC86634.1| 1012|Homo sapiens protein ( Homo sapiens cDNA FLJ44709 fis, clone BRACE3019570, highly similar to Rattus norvegicus SNAP-25-interacting protein (SNIP). ). Length = 1012 Score = 28.3 bits (60), Expect = 9.7 Identities = 19/55 (34%), Positives = 26/55 (47%), Gaps = 1/55 (1%) Frame = +3 Query: 201 PRPSAGPCMTPEGL-VLPDTNPGLA*QINRLELSEWLRRTQRPSRTGPDPCPPRR 362 P P P P G P T P + L + + RT++PS++ P P PPRR Sbjct: 832 PTPDHKPPKAPHGQKAAPRTEPSGRRGSDELTVPRY--RTEKPSKSPPPP-PPRR 883 >AK095913-1|BAC04645.1| 160|Homo sapiens protein ( Homo sapiens cDNA FLJ38594 fis, clone HEART2000541. ). Length = 160 Score = 28.3 bits (60), Expect = 9.7 Identities = 15/43 (34%), Positives = 18/43 (41%) Frame = +3 Query: 228 TPEGLVLPDTNPGLA*QINRLELSEWLRRTQRPSRTGPDPCPP 356 T G V PD+ P Q + E + W R R R CPP Sbjct: 3 TAAGAVSPDSRPETRRQTRKNEEAAWGPRVCRAEREDNRKCPP 45 >AB127405-1|BAD03968.1| 1183|Homo sapiens SNAP-25-interacting protein protein. Length = 1183 Score = 28.3 bits (60), Expect = 9.7 Identities = 19/55 (34%), Positives = 26/55 (47%), Gaps = 1/55 (1%) Frame = +3 Query: 201 PRPSAGPCMTPEGL-VLPDTNPGLA*QINRLELSEWLRRTQRPSRTGPDPCPPRR 362 P P P P G P T P + L + + RT++PS++ P P PPRR Sbjct: 960 PTPDHKPPKAPHGQKAAPRTEPSGRRGSDELTVPRY--RTEKPSKSPPPP-PPRR 1011 >AB051471-1|BAB21775.1| 762|Homo sapiens KIAA1684 protein protein. Length = 762 Score = 28.3 bits (60), Expect = 9.7 Identities = 19/55 (34%), Positives = 26/55 (47%), Gaps = 1/55 (1%) Frame = +3 Query: 201 PRPSAGPCMTPEGL-VLPDTNPGLA*QINRLELSEWLRRTQRPSRTGPDPCPPRR 362 P P P P G P T P + L + + RT++PS++ P P PPRR Sbjct: 539 PTPDHKPPKAPHGQKAAPRTEPSGRRGSDELTVPRY--RTEKPSKSPPPP-PPRR 590 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 61,433,269 Number of Sequences: 237096 Number of extensions: 1423413 Number of successful extensions: 3870 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 3615 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3862 length of database: 76,859,062 effective HSP length: 82 effective length of database: 57,417,190 effective search space used: 2813442310 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -