BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0835 (649 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC23C11.06c |||hydrolase |Schizosaccharomyces pombe|chr 1|||Ma... 27 3.1 SPAC29A4.18 |prw1||Clr6 histone deacetylase complex subunit Prw1... 25 9.4 >SPAC23C11.06c |||hydrolase |Schizosaccharomyces pombe|chr 1|||Manual Length = 535 Score = 26.6 bits (56), Expect = 3.1 Identities = 21/59 (35%), Positives = 24/59 (40%), Gaps = 1/59 (1%) Frame = +2 Query: 131 WYSPVW-LWPMAALNLQWDTATPLPEVTQEASALPLSAADTERCYWWSFWIPRWPFWRQ 304 W S + LW A L W T L Q P A R Y+WS+ WP WRQ Sbjct: 139 WRSNAFVLW--AFLMSLWIVITDLMLFRQYKEEHPDYDAIAHRGYYWSWSPSTWP-WRQ 194 >SPAC29A4.18 |prw1||Clr6 histone deacetylase complex subunit Prw1|Schizosaccharomyces pombe|chr 1|||Manual Length = 431 Score = 25.0 bits (52), Expect = 9.4 Identities = 10/26 (38%), Positives = 13/26 (50%) Frame = +1 Query: 523 STPETLQDHLHQGPNSSHSYCPHNSY 600 ST H H GP S ++ PHN + Sbjct: 270 STKPARSVHAHSGPIHSVAFNPHNDF 295 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,076,210 Number of Sequences: 5004 Number of extensions: 34126 Number of successful extensions: 119 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 116 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 119 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 291768710 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -