BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0835 (649 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY703685-1|AAU12681.1| 200|Apis mellifera abdominal-A protein. 23 2.5 AF388659-3|AAK71993.1| 548|Apis mellifera 1D-myo-inositol-trisp... 22 5.9 AF388659-2|AAK71994.1| 463|Apis mellifera 1D-myo-inositol-trisp... 22 5.9 AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisp... 22 5.9 EF531707-1|ABP57431.1| 138|Apis mellifera structural cuticle pr... 21 7.8 DQ011226-1|AAY63895.1| 471|Apis mellifera Rh-like protein protein. 21 7.8 AF084556-1|AAC71015.1| 652|Apis mellifera pipsqueak protein. 21 7.8 >AY703685-1|AAU12681.1| 200|Apis mellifera abdominal-A protein. Length = 200 Score = 23.0 bits (47), Expect = 2.5 Identities = 13/39 (33%), Positives = 20/39 (51%) Frame = -3 Query: 404 SSITSEAQTAAAAKGESTTETESIRRVSAAKGNAASRKA 288 ++ +S A AAAA +T +S R ++ GN A A Sbjct: 125 TAASSAALAAAAAVDAATAGDKSCRYTASLAGNVAPASA 163 >AF388659-3|AAK71993.1| 548|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform C protein. Length = 548 Score = 21.8 bits (44), Expect = 5.9 Identities = 14/45 (31%), Positives = 20/45 (44%) Frame = +1 Query: 445 LYRNTSMFTYLPQNQLSKDFLDPCCGSTPETLQDHLHQGPNSSHS 579 L N + Y+P+ + D D G+ ET + HQ SS S Sbjct: 275 LLMNDILRPYVPEFKGVLDVKDVEEGNVEETNSEETHQKDGSSDS 319 >AF388659-2|AAK71994.1| 463|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform B protein. Length = 463 Score = 21.8 bits (44), Expect = 5.9 Identities = 14/45 (31%), Positives = 20/45 (44%) Frame = +1 Query: 445 LYRNTSMFTYLPQNQLSKDFLDPCCGSTPETLQDHLHQGPNSSHS 579 L N + Y+P+ + D D G+ ET + HQ SS S Sbjct: 190 LLMNDILRPYVPEFKGVLDVKDVEEGNVEETNSEETHQKDGSSDS 234 >AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform A protein. Length = 782 Score = 21.8 bits (44), Expect = 5.9 Identities = 14/45 (31%), Positives = 20/45 (44%) Frame = +1 Query: 445 LYRNTSMFTYLPQNQLSKDFLDPCCGSTPETLQDHLHQGPNSSHS 579 L N + Y+P+ + D D G+ ET + HQ SS S Sbjct: 509 LLMNDILRPYVPEFKGVLDVKDVEEGNVEETNSEETHQKDGSSDS 553 >EF531707-1|ABP57431.1| 138|Apis mellifera structural cuticle protein protein. Length = 138 Score = 21.4 bits (43), Expect = 7.8 Identities = 8/23 (34%), Positives = 12/23 (52%), Gaps = 2/23 (8%) Frame = +3 Query: 468 HVPPPEPVEQRLPRSLLW--LHP 530 H+P P+ + R+L W HP Sbjct: 102 HIPTAPPIPPEIQRALEWNAAHP 124 >DQ011226-1|AAY63895.1| 471|Apis mellifera Rh-like protein protein. Length = 471 Score = 21.4 bits (43), Expect = 7.8 Identities = 6/10 (60%), Positives = 9/10 (90%) Frame = +3 Query: 441 PLVQKHIYVH 470 PL+QKH+ +H Sbjct: 317 PLIQKHLKIH 326 >AF084556-1|AAC71015.1| 652|Apis mellifera pipsqueak protein. Length = 652 Score = 21.4 bits (43), Expect = 7.8 Identities = 7/19 (36%), Positives = 10/19 (52%) Frame = +1 Query: 547 HLHQGPNSSHSYCPHNSYP 603 H HQ P+ +HS + P Sbjct: 630 HFHQSPSQNHSSAVPDQMP 648 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 145,893 Number of Sequences: 438 Number of extensions: 2489 Number of successful extensions: 7 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 19560480 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -