BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0834 (695 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY127579-1|AAN02286.1| 405|Apis mellifera venom protease precur... 27 0.13 DQ325087-1|ABD14101.1| 179|Apis mellifera complementary sex det... 21 8.5 DQ325086-1|ABD14100.1| 179|Apis mellifera complementary sex det... 21 8.5 DQ325085-1|ABD14099.1| 179|Apis mellifera complementary sex det... 21 8.5 DQ325084-1|ABD14098.1| 179|Apis mellifera complementary sex det... 21 8.5 DQ288392-1|ABC41342.1| 120|Apis mellifera nanos protein. 21 8.5 >AY127579-1|AAN02286.1| 405|Apis mellifera venom protease precursor protein. Length = 405 Score = 27.5 bits (58), Expect = 0.13 Identities = 10/33 (30%), Positives = 19/33 (57%) Frame = -3 Query: 360 TICNDRYILSLNHCEIETRKTIMMTIFTKKNWN 262 TI + RY+L+ HC I+ T + + + +W+ Sbjct: 191 TIISKRYVLTAAHCIIDENTTKLAIVVGEHDWS 223 >DQ325087-1|ABD14101.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 21.4 bits (43), Expect = 8.5 Identities = 9/26 (34%), Positives = 16/26 (61%) Frame = -2 Query: 322 LRNRNEKDNYDDYFHKKKLEHIIYHL 245 + N N K NY++ + KKL + I ++ Sbjct: 90 IHNNNYKYNYNNNNYNKKLYYNINYI 115 >DQ325086-1|ABD14100.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 21.4 bits (43), Expect = 8.5 Identities = 9/26 (34%), Positives = 16/26 (61%) Frame = -2 Query: 322 LRNRNEKDNYDDYFHKKKLEHIIYHL 245 + N N K NY++ + KKL + I ++ Sbjct: 90 IHNNNYKYNYNNNNYNKKLYYNINYI 115 >DQ325085-1|ABD14099.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 21.4 bits (43), Expect = 8.5 Identities = 9/26 (34%), Positives = 16/26 (61%) Frame = -2 Query: 322 LRNRNEKDNYDDYFHKKKLEHIIYHL 245 + N N K NY++ + KKL + I ++ Sbjct: 90 IHNNNYKYNYNNNNYNKKLYYNINYI 115 >DQ325084-1|ABD14098.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 21.4 bits (43), Expect = 8.5 Identities = 9/26 (34%), Positives = 16/26 (61%) Frame = -2 Query: 322 LRNRNEKDNYDDYFHKKKLEHIIYHL 245 + N N K NY++ + KKL + I ++ Sbjct: 90 IHNNNYKYNYNNNNYNKKLYYNINYI 115 >DQ288392-1|ABC41342.1| 120|Apis mellifera nanos protein. Length = 120 Score = 21.4 bits (43), Expect = 8.5 Identities = 7/13 (53%), Positives = 10/13 (76%) Frame = -2 Query: 247 LFCVHNGETKFYY 209 +FC +NGE + YY Sbjct: 41 VFCRNNGEEEAYY 53 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 182,765 Number of Sequences: 438 Number of extensions: 4390 Number of successful extensions: 9 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21317625 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -