BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0830 (670 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AC090999-3|AAK26147.1| 536|Caenorhabditis elegans Hypothetical ... 28 5.2 U56961-3|AAK39294.1| 634|Caenorhabditis elegans Hypothetical pr... 28 6.9 Z82057-5|CAB04861.3| 325|Caenorhabditis elegans Hypothetical pr... 27 9.1 Z81142-11|CAB03512.3| 325|Caenorhabditis elegans Hypothetical p... 27 9.1 AL132863-5|CAB60571.1| 275|Caenorhabditis elegans Hypothetical ... 27 9.1 >AC090999-3|AAK26147.1| 536|Caenorhabditis elegans Hypothetical protein Y82E9BR.7 protein. Length = 536 Score = 28.3 bits (60), Expect = 5.2 Identities = 12/22 (54%), Positives = 14/22 (63%) Frame = +2 Query: 215 DVKNKSLTINSMHGVCVKYMVC 280 D K +TIN M+GVCVK C Sbjct: 136 DGSGKLVTINQMNGVCVKNSKC 157 >U56961-3|AAK39294.1| 634|Caenorhabditis elegans Hypothetical protein T19D7.4 protein. Length = 634 Score = 27.9 bits (59), Expect = 6.9 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = +1 Query: 103 HYYDCILYFYNHKFRQDYTIKNINKDKQ 186 H +D ILYFYN K +D T + K Q Sbjct: 492 HIWDVILYFYNLKTGRDTTDAPVRKLSQ 519 >Z82057-5|CAB04861.3| 325|Caenorhabditis elegans Hypothetical protein ZK1037.11 protein. Length = 325 Score = 27.5 bits (58), Expect = 9.1 Identities = 12/31 (38%), Positives = 19/31 (61%) Frame = +2 Query: 32 TIIITRGPAVVEIRL*LIGIVSLYTIMIVFY 124 T+++ E+ LIGI S+YT ++VFY Sbjct: 108 TVVVIIIAITNEVNELLIGIFSIYTFIVVFY 138 >Z81142-11|CAB03512.3| 325|Caenorhabditis elegans Hypothetical protein ZK1037.11 protein. Length = 325 Score = 27.5 bits (58), Expect = 9.1 Identities = 12/31 (38%), Positives = 19/31 (61%) Frame = +2 Query: 32 TIIITRGPAVVEIRL*LIGIVSLYTIMIVFY 124 T+++ E+ LIGI S+YT ++VFY Sbjct: 108 TVVVIIIAITNEVNELLIGIFSIYTFIVVFY 138 >AL132863-5|CAB60571.1| 275|Caenorhabditis elegans Hypothetical protein Y37H2A.9 protein. Length = 275 Score = 27.5 bits (58), Expect = 9.1 Identities = 19/63 (30%), Positives = 34/63 (53%), Gaps = 4/63 (6%) Frame = -1 Query: 574 ANISRAHEVIDRA*AGKFESYYLHSLQINRKSRMFLSI-YILIREAKTLYPF---LRKLR 407 AN+ +HEV +A G++++ + +L +N+ + Y L E K PF +++L Sbjct: 54 ANLLSSHEVHYQALGGEYKTLVIKALTLNQTKISVNGVEYSLGTENKFKAPFTLAMKQLE 113 Query: 406 GRR 398 GRR Sbjct: 114 GRR 116 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,744,389 Number of Sequences: 27780 Number of extensions: 302892 Number of successful extensions: 667 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 643 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 667 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1508017654 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -