BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0827 (552 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ244075-1|ABB36785.1| 548|Apis mellifera cytochrome P450 monoo... 26 0.29 D79207-1|BAA23639.1| 432|Apis mellifera milk protein protein. 23 2.7 AF388203-1|AAM73637.1| 432|Apis mellifera major royal jelly pro... 23 2.7 AF000633-1|AAC61895.1| 432|Apis mellifera major royal jelly pro... 23 2.7 AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein ... 22 3.6 >DQ244075-1|ABB36785.1| 548|Apis mellifera cytochrome P450 monooxygenase protein. Length = 548 Score = 25.8 bits (54), Expect = 0.29 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = +1 Query: 64 IDSSTDFLADTQLLASGLMCAGGPTFRNERRL 159 ID ST++ L GL+ + G +RN R+L Sbjct: 109 IDKSTEYRFFKPWLGDGLLISTGQKWRNHRKL 140 >D79207-1|BAA23639.1| 432|Apis mellifera milk protein protein. Length = 432 Score = 22.6 bits (46), Expect = 2.7 Identities = 15/46 (32%), Positives = 20/46 (43%) Frame = +2 Query: 284 TASLYL*LEQHASADSVNGEKPRVHAQAQLDVPSEGVHRVLENDGS 421 T +LY S VN E+ R Q D+ EGV +L+ S Sbjct: 262 TNNLYYSPVASTSLYYVNTEQFRTSDYQQNDIHYEGVQNILDTQSS 307 >AF388203-1|AAM73637.1| 432|Apis mellifera major royal jelly protein MRJP1 protein. Length = 432 Score = 22.6 bits (46), Expect = 2.7 Identities = 15/46 (32%), Positives = 20/46 (43%) Frame = +2 Query: 284 TASLYL*LEQHASADSVNGEKPRVHAQAQLDVPSEGVHRVLENDGS 421 T +LY S VN E+ R Q D+ EGV +L+ S Sbjct: 262 TNNLYYSPVASTSLYYVNTEQFRTSDYQQNDIHYEGVQNILDTQSS 307 >AF000633-1|AAC61895.1| 432|Apis mellifera major royal jelly protein MRJP1 protein. Length = 432 Score = 22.6 bits (46), Expect = 2.7 Identities = 15/46 (32%), Positives = 20/46 (43%) Frame = +2 Query: 284 TASLYL*LEQHASADSVNGEKPRVHAQAQLDVPSEGVHRVLENDGS 421 T +LY S VN E+ R Q D+ EGV +L+ S Sbjct: 262 TNNLYYSPVASTSLYYVNTEQFRTSDYQQNDIHYEGVQNILDTQSS 307 >AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein protein. Length = 1124 Score = 22.2 bits (45), Expect = 3.6 Identities = 10/31 (32%), Positives = 16/31 (51%) Frame = +2 Query: 380 PSEGVHRVLENDGSHVSVHDVTSPPTAAAYE 472 P E + + NDG S+ DV++P Y+ Sbjct: 914 PGELLSSCVSNDGGCSSLVDVSTPVNKKVYK 944 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 156,411 Number of Sequences: 438 Number of extensions: 3279 Number of successful extensions: 6 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 15827139 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -